KEGG   Staphylococcus aureus RF122: SAB0613Help
Entry
SAB0613           CDS       T00303                                 

Definition
(GenBank) low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sab  Staphylococcus aureus RF122
Brite
KEGG Orthology (KO) [BR:sab00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SAB0613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CAI80301
Position
679417..680424
Genome map
AA seq 335 aa AA seqDB search
MSYIIIVTIAVVIFSLIFDFINGFHDTANAVATAVSTRALTPKTAILMAAVMNFIGALTF
TGVAGTITKDIVDPFKLENGLVVVLAAILAAIIWNLATWFYGIPSSSSHALIGSIAGAAI
ASEGSFGVLHYQGFTKIIIVLIVSPIIAFCVGFLMYSIFKVIFKNANLTRANRNFRFFQI
FTAALQSFSHGTNDAQKSMGIITLALIVANVQNDGSVEPQLWVKFACATAMGLGTAIGGW
KIIKTVGGNIMKIRPANGAAADLSSALTIFVASSLHFPLSTTHVVSSSILGVGASNRAKG
VKWSTAQRMIITWVITLPISAFLAAFLFYILSLFF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatataatcatcgtcactatagctgtagttattttctcgctgatatttgacttt
atcaatggattccatgatacagccaatgcagtagctactgctgtatctactagagcgtta
acgcctaaaacggcaattttaatggcagcagtgatgaactttataggtgctttaacattt
acgggtgttgcaggcaccattactaaagacattgtcgatccatttaaattggaaaatgga
ttagttgttgtgttagctgcaatacttgcggctattatttggaatttagctacttggttt
tacggaattccaagttcgtcttcacatgcacttataggttcaattgcgggtgcagcaatc
gcatctgaaggctcatttggagtgttacattaccaaggtttcacaaaaattattattgta
ttaatcgtttcgccgattatcgcattttgtgttggtttcttgatgtattcaatttttaaa
gttatctttaaaaacgcaaatttaacaagagcgaatcgtaattttagatttttccaaatt
ttcacagcagcgttacaatcattctctcacggtacgaatgatgcgcaaaaatcaatgggt
attattacgttggcattgattgttgctaatgtacagaatgatggcagcgttgaaccacag
ttatgggtaaaatttgcctgtgcgacagcaatggggcttggtactgcaattggtggctgg
aaaattatcaaaactgtaggtggtaatattatgaaaatacgtcctgcaaatggtgcagcg
gccgatttatcatctgcattaacaatttttgttgcgtcatctctgcatttcccattatca
actacacacgttgtgtcatcatcaattttaggtgttggtgcttctaacagagctaaaggt
gttaaatggagcactgctcaacgtatgattattacatgggtgattacattaccgatatct
gcgtttttagcagcgtttttattctatatacttagcttatttttctaa

DBGET integrated database retrieval system