KEGG   Staphylococcus aureus RF122: SAB1057Help
Entry
SAB1057           CDS       T00303                                 

Gene name
ileS
Definition
(GenBank) isoleucyl-tRNA synthetase
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
sab  Staphylococcus aureus RF122
Pathway
sab00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sab00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SAB1057 (ileS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sab01007]
    SAB1057 (ileS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sab03016]
    SAB1057 (ileS)
Enzymes [BR:sab01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     SAB1057 (ileS)
Amino acid related enzymes [BR:sab01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SAB1057 (ileS)
Transfer RNA biogenesis [BR:sab03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SAB1057 (ileS)
 Prokaryotic type
   Other AARSs
    SAB1057 (ileS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g zf-FPG_IleRS tRNA-synt_1e tRNA-synt_1_2 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: CAI80746
UniProt: Q2YXH4
Structure
PDB: 

Position
1138302..1141055
Genome map
AA seq 917 aa AA seqDB search
MDYKETLLMPKTDFPMRGGLPNKEPQIQEKWDAEDQYHKALEKNKGNETFILHDGPPYAN
GNLHMGHALNKILKDFIVRYKTMQGFYAPYVPGWDTHGLPIEQALTKKGVDRKKMSTAEF
REKCKEFALEQIELQKKDFRRLGVRGDFNDPYITLKPEYEAAQIRIFGEMADKGLIYKGK
KPVYWSPSSESSLAEAEIEYHDKRSASIYVAFDVKDDKGVVDADAKFIIWTTTPWTIPSN
VAITVHPELKYGQYNVNGEKYIIAEALSDAVAEALDWDKASIELEKEYTGKELEYVVAQH
PFLDRESLVINGDHVTTDAGTGCVHTAPGHGEDDYIVGQKYELPVISPIDDKGVFTEEGG
QFEGMFYDKANKAVTDLLTEKGALLKLDFITHSYPHDWRTKKPVIFRATPQWFASISKVR
QDILDAIENTNFKVNWGKTRIYNMVRDRGEWVISRQRVWGVPLPVFYAENGEIIMTKETV
NHVADLFAEHGSNIWFEREAKDLLPEGFTHPGSPNGTFTKETDIMDVWFDSGSSHRGVLE
TRPELSFPADMYLEGSDQYRGWFNSSITTSVATRGVSPYKFLLSHGFVMDGEGKKMSKSL
GNVIVPDQVVKQKGADIARLWVSSTDYLADVRISDEILKQTSDVYRKIRNTLRFMLGNIN
DFNPDTDSIPESELLEVDRYLLNRLREFTASTINNYENFDYLNIYQEVQNFLNVELSNFY
LDYGKDILYIEQRDSHIRRSMQTVLYQILVDMTKLLAPILVHTAEEVWSHTPHVKEESVH
LADMPKVVEVDQALLDKWRTFMNLRDDVNRALETARNEKVIGKSLEAKVTIASNDKFNAS
EFLTSFDALHQLFIVSQVKVVDKLDDQATAYEHGDIVIEHADGEKCERCWNYSEDLGAVD
ELTHLCPRCQQVVKSLV
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atggattacaaagaaacgttattaatgcctaaaacagatttcccaatgcgaggtggttta
ccaaacaaggaaccgcaaattcaagaaaaatgggatgcagaagatcaataccataaagcg
ttagaaaaaaataaaggtaacgaaacattcattttacatgatggcccaccatacgcgaat
ggtaacttacatatgggacatgccttgaacaaaattttaaaagactttattgtacgttat
aaaactatgcaagggttctatgcaccatacgtaccaggttgggatacacatggtttacca
attgaacaagcattaacgaaaaaaggtgttgaccgtaagaaaatgtcaacagctgaattc
cgtgagaaatgtaaagaatttgctttagaacaaattgaattacaaaaaaaagattttaga
cgtttaggtgttcgtggtgactttaatgatccatatattacattaaaacctgaatacgaa
gctgcacaaattcgtatttttggagaaatggcagataaaggtttaatttataaaggtaaa
aagccagtttattggtctccttcaagtgagtcttcattagcagaagcagaaattgaatat
cacgataaacgttcagcatcaatttacgttgcatttgacgttaaagatgacaaaggtgtc
gttgatgcagatgctaaatttattatctggacaacaacgccatggacaattccatcaaat
gttgcgattaccgttcatcctgaattaaaatatggtcaatacaatgtaaatggcgaaaaa
tatattattgcagaagccttatctgacgctgtagcagaagcactggattgggataaagca
tcaatcgaattagaaaaagaatacacaggtaaagaattggagtatgttgtagcacaacat
ccattcttagatagagaatcgttagtgattaatggtgatcatgttactacagatgctggt
acaggttgtgtacatacagcaccaggtcacggggaagatgactatattgttggtcaaaaa
tatgaattgccagtaattagtccaatcgatgataaaggtgtatttactgaagaaggcggc
caatttgaaggaatgttctatgataaagctaataaagccgttactgatttattaacagaa
aaaggtgcactattaaaattagactttattacacatagctatccacacgactggagaaca
aaaaaacctgtaatcttccgtgctacaccacaatggtttgcctcaatcagtaaagtaaga
caagatattttagatgcaatcgaaaatacaaacttcaaagtaaattggggtaaaacacgt
atttacaatatggttcgtgaccgtggcgaatgggttatttctcgtcaacgtgtttggggt
gtaccgttaccagtattttatgctgaaaatggcgaaattatcatgacgaaagaaacagtg
aatcatgttgctgatttatttgcagaacacggttcaaatatttggtttgaaagagaagcg
aaagacttactaccagaaggatttacacatccaggcagccctaacggtacatttactaaa
gaaacagacattatggacgtttggtttgattctggttcatcacaccgtggcgtgttggaa
acaagaccggaattaagtttcccagcggatatgtatttagaaggtagtgaccaatatcgt
ggttggttcaactcttctatcacaacttcagttgctacaagaggagtatcaccttataaa
ttcttactttctcatggttttgttatggacggtgaaggtaagaaaatgagtaaatcttta
ggtaatgtgattgtacctgaccaagtggttaaacaaaaaggtgctgatattgcgagactt
tgggtaagtagtacggactatttagctgatgttagaatttctgatgaaattttaaaacaa
acatctgatgtttatcgtaaaatcagaaatacattaagatttatgttaggtaatattaat
gatttcaatcctgatacagatagcattcctgaatcggagttattagaagttgatcgttac
ttgctaaatcgtttacgtgaatttactgcaagtacgattaacaactatgaaaactttgac
tacttaaatatttatcaagaagttcaaaactttctcaatgttgagttgagtaatttctat
ttggattacggtaaagatattttatatattgaacaacgtgattctcatatccgtcgtagt
atgcaaacagtgttatatcaaattttagttgatatgacgaagttgttagcaccaatctta
gtgcatacagctgaagaagtttggtctcatacaccacatgttaaagaagaaagtgttcac
ttagcagacatgcctaaagttgtagaagtagatcaagctttattggataaatggcgtaca
tttatgaatttacgtgatgatgtgaaccgtgcattagaaactgctcgtaatgaaaaagtt
attggtaaatcattagaagctaaagttacgattgctagtaacgataaatttaatgcatct
gaattcttaacttcatttgatgcattacatcaattatttatcgtgtcacaagttaaagtt
gtagataagttagatgatcaggcaacagcttatgaacatggtgatattgtcatcgaacat
gcagatggtgaaaaatgtgaaagatgttggaactattcagaggatcttggtgctgttgat
gaattgacgcatctatgcccacgatgccaacaagttgtaaaatcacttgtataa

DBGET integrated database retrieval system