KEGG   Staphylococcus aureus RF122: SAB1110Help
Entry
SAB1110           CDS       T00303                                 

Definition
(GenBank) succinyl-CoA synthetase alpha chain
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
sab  Staphylococcus aureus RF122
Pathway
sab00020  Citrate cycle (TCA cycle)
sab00640  Propanoate metabolism
sab00660  C5-Branched dibasic acid metabolism
sab01100  Metabolic pathways
sab01110  Biosynthesis of secondary metabolites
sab01120  Microbial metabolism in diverse environments
sab01130  Biosynthesis of antibiotics
sab01200  Carbon metabolism
Module
sab_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sab_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAB1110
   00640 Propanoate metabolism
    SAB1110
   00660 C5-Branched dibasic acid metabolism
    SAB1110
Enzymes [BR:sab01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SAB1110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: CAI80799
Position
1199937..1200845
Genome map
AA seq 302 aa AA seqDB search
MSVFIDKNTKVMVQGITGSTALFHTKQMLDYGTKIVAGVTPGKGGQVVEGVPVFNTVEEA
KNETGATVSVIYVPAPFAADSILEAADADLDMVICITEHIPVLDMVKVKRYLQGRKTRLV
GPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTAVGIGG
DPVNGTNFIDVLKAFNEDDETKAVVMIGEIGGTAEEEAAEWIKANMTKPVVGFIGGQTAP
PGKRMGHAGAIISGGKGTAEEKIKTLNSCGVKTAATPSEIGSTLIEAAKEAGIYESLLTV
NK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtatttatagataagaatactaaagtaatggtacaaggtattacagggtctact
gcccttttccatacaaaacaaatgcttgattatggtacgaaaatagtagcaggtgtgacg
cctggtaaaggtggtcaagttgttgaaggcgttcctgttttcaacactgttgaagaagct
aaaaatgaaactggggcaacggtttcagtcatttacgttccagcaccatttgctgcagac
tcaattttagaagcagctgatgcagacttagatatggttatttgtatcactgaacatatt
cctgtattagacatggttaaagttaaacgctacttacaaggtagaaaaacacgtttagtt
ggtccaaactgtccaggtgtgattacagcagatgaatgtaaaattggtattatgcctggc
tatattcacaaaaaaggtcatgttggtgtagtatcacgttcaggtacactaacatatgaa
gcagtgcaccaattgactgaagaaggtattggtcaaactacagctgttggtattggtgga
gacccagtcaacggaacaaactttattgatgttttaaaagcattcaatgaagatgacgaa
acgaaagcagttgttatgattggtgaaatcggtggtacagctgaagaagaagcagctgaa
tggattaaagcgaatatgacaaaaccagttgtaggctttatcggtggacaaacagcacct
cctggaaaacgtatgggacatgctggtgcgatcatttcaggtggtaaaggtactgctgaa
gagaaaattaaaacattaaatagttgtggtgtgaaaacagcggcaacaccttcagaaatt
ggttcaacattaattgaagctgctaaagaagcaggtatttatgaatcattattaacagtt
aataaataa

DBGET integrated database retrieval system