KEGG   Staphylococcus aureus RF122: SAB1321cHelp
Entry
SAB1321c          CDS       T00303                                 

Gene name
papS
Definition
(GenBank) probable PolyA polymerase family protein
  KO
K00974  tRNA nucleotidyltransferase (CCA-adding enzyme) [EC:2.7.7.72 3.1.3.- 3.1.4.-]
Organism
sab  Staphylococcus aureus RF122
Brite
KEGG Orthology (KO) [BR:sab00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sab03016]
    SAB1321c (papS)
Enzymes [BR:sab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.72  CCA tRNA nucleotidyltransferase
     SAB1321c (papS)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     SAB1321c (papS)
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.-  
     SAB1321c (papS)
Transfer RNA biogenesis [BR:sab03016]
 Eukaryotic type
  3'processing and CCA adding factors
   CCA adding factors
    SAB1321c (papS)
 Prokaryotic type
    SAB1321c (papS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PolyA_pol tRNA_NucTran2_2 PolyA_pol_RNAbd
Motif
Other DBs
NCBI-ProteinID: CAI81010
UniProt: Q2YY49
Position
complement(1449798..1451000)
Genome map
AA seq 400 aa AA seqDB search
MDKSLFEQARPILEQIQDNGFEAYYVGGSVRDYVMGRNIHDIDITTSATPDEIESIFSHT
IPVGKEHGTINVVFNNENYEVTTFRAEEDYVDHRRPSGVTFVRDLYEDLQRRDFTMNAIA
MDTAYKLYDYFDGQQDINNRIIRTVGIAAERFQEDALRMIRCLRFQSQLSFEIATETFEA
MRTQMADIKFLSIERIVIELTKLMRGINVEKSFNHLKSLKAFNYMPYFEHLDMNQINVTE
PIDLELLIAIVSVKFDINYSLKPLKLSNRQVKDINQYIQIMNALPSIFTKEQLKIFVYDY
DTNLIKNIMVAADVLKANDIQGHEPLIVNLQTIDETLHHLPMHNRKDMMVNGGVLMAHLN
AKSGPWLKDVLRQIEIAIVTGKVSNEETEILKWVDNHVKI
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggataaatcattatttgaacaggcaaggcctatattagaacaaattcaagacaatggt
tttgaagcatattatgtaggtggctctgtaagagattatgtcatgggaagaaatattcat
gatatagatatcacaacaagtgcaacgccagatgaaatagaatctatctttagtcatacg
atacctgtaggtaaagaacatggcaccataaatgtagtttttaataatgaaaattatgaa
gtgacaacattccgggctgaagaagattatgtcgatcaccgtagaccaagtggtgttaca
tttgttcgtgatttatacgaagatttgcaacgaagagatttcacgatgaatgcgatagca
atggatacagcatacaaattgtatgattattttgatggtcaacaagatattaataatcga
ataataagaactgtaggtatagctgcggaacgattccaagaagatgctttacgcatgatt
cgatgtttaagattccagtcacaattatcatttgagattgcaacggaaacatttgaagcg
atgcgtacacaaatggcagatattaaatttttatcaattgagcgtatagtgattgaacta
actaaattaatgcgaggtattaatgttgaaaagagttttaatcatttaaaatcgctgaaa
gcatttaattatatgccatatttcgaacatcttgatatgaatcaaattaatgtgactgaa
ccaattgatttagaattgttgattgctatagtgtcagttaaatttgatattaattactca
ttaaagcctttaaagctaagtaaccgacaagtaaaagatatcaatcaatatattcaaatt
atgaatgcattaccaagtatttttacaaaagaacaattaaaaatctttgtttatgattat
gatacgaatctcattaaaaatataatggttgcagcagacgtgttaaaggcaaatgatatt
caaggacatgaaccattaatcgttaaccttcaaacgattgatgaaacattacatcactta
cctatgcataatagaaaagacatgatggttaatggcggtgtactaatggcacatttaaat
gccaaaagtggtccgtggttaaaagatgtgctaagacaaattgagatagcgattgtaaca
ggtaaagtaagcaacgaagaaactgaaattttgaaatgggtggataatcatgtcaaaata
tag

DBGET integrated database retrieval system