KEGG   Staphylococcus aureus RF122: SAB1877Help
Entry
SAB1877           CDS       T00303                                 

Definition
(GenBank) probable succinyldiaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sab  Staphylococcus aureus RF122
Pathway
sab00300  Lysine biosynthesis
sab01100  Metabolic pathways
sab01120  Microbial metabolism in diverse environments
sab01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sab00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SAB1877
Enzymes [BR:sab01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SAB1877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: CAI81566
Position
2014391..2015614
Genome map
AA seq 407 aa AA seqDB search
MTTFSENEKIQLLADIVELQTENNNEIDVCNYLKDLFDKYDIKSEILKVNEHRANIVAEI
GNGSPILVLSGHMDVVDAGNQDNWTYPPFQLTEKDGKLYGRGTTDMKGGLMALVITLIEL
KEQNQLPQGTIRLLATAGEEKEQEGAKLLADKGYLDDVDGLIIAEPTGSGIYYAHKGSMS
CKVTAIGKAVHSSVPFIGDNAIDTLLEFYNQFKEKYSELKKHDTKHELDVAPMFKSLIGK
EISEEDANYASGLTAVCSIINGGKQFNSVPDEASLEFNVRPVPEYDNDFIESFFQNIINN
VDSNKLSLDIPSNHRPVTSDKNSKLITTIKDVASSYVNKDDIFVSALVGATDASSFLGDN
KDNVDLAIFGPGNPLMAHQIDEYIEKDMYLKYIDIFKEASIQYLKEK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttttagtgaaaatgaaaaaattcaattactagcagatattgttgaactacaa
actgaaaataataatgaaatagacgtttgtaattatttaaaagatttattcgacaagtac
gatattaaatctgaaattttgaaagttaatgaacaccgcgccaatatcgttgcagaaatc
ggtaacggctcacctatactcgtattgagtggtcatatggatgttgttgatgcaggaaat
caagataattggacttatcccccttttcaactcacagaaaaagatggcaaattatacggt
cgaggcacaacggatatgaaaggcggtctgatggctttggtcatcacactcattgaatta
aaagaacaaaatcaattgcctcaaggaacgataagattactagctactgctggcgaagag
aaagaacaagaaggtgccaaattattggctgataaaggctatttagacgatgtagatggc
ttaattattgctgaaccaactggatctggaatttattatgcacataaagggtctatgtca
tgtaaagtaactgcaattggtaaagctgtccatagctcagttccatttattggtgacaat
gcaattgatacactgcttgaattttataatcaatttaaagaaaaatattcagagcttaaa
aaacatgatactaaacatgaattagatgttgcacccatgttcaaatcattgataggaaaa
gaaatttctgaagaggatgcaaattatgcatctggtcttacagctgtatgttcgattata
aatggcggcaaacaatttaactctgtaccagatgaagcttcacttgaatttaacgtaaga
ccagttcctgagtatgataacgactttatagaatcgtttttccaaaatatcattaataat
gtggatagcaataagctttcactcgatattccaagcaatcaccgacctgtaacaagcgat
aaaaatagcaaattaattactacgattaaagatgtagcttctagttatgtaaacaaagac
gatatatttgtttcggcgcttgtaggtgcaacagatgcctctagtttcttaggtgataat
aaggacaatgttgatttagccatttttggaccaggtaatccattaatggcacatcaaatc
gatgaatatattgaaaaagatatgtatctgaaatatattgatatttttaaagaggcttcc
attcaatatttaaaagaaaaataa

DBGET integrated database retrieval system