KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL0113
Entry
SACOL0113         CDS       T00225                                 

Name
(GenBank) NAD-dependent epimerase/dehydratase family protein
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00052  Galactose metabolism
sac00520  Amino sugar and nucleotide sugar metabolism
sac00541  O-Antigen nucleotide sugar biosynthesis
sac01100  Metabolic pathways
sac01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:sac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SACOL0113
   00520 Amino sugar and nucleotide sugar metabolism
    SACOL0113
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    SACOL0113
Enzymes [BR:sac01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     SACOL0113
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 NAD_binding_10 Sacchrp_dh_NADP adh_short KR
Other DBs
NCBI-ProteinID: AAW38756
UniProt: A0A0H2X072
Position
127490..128461
AA seq 323 aa
MERVLITGGAGFIGSHLVDDLQQDYDVYVLDNYRTGKRENIKSLADDHVFELDIREYDAV
EQIMKTYQFDYVIHLAALVSVAESVEKPILSQEINVVATLRLLEIIKKYNNHIKRFIFAS
SAAVYGDLPDLPKSDQSLILPLSPYAIDKYYGERTTLNYCSLYNIPTAVVKFFNVFGPRQ
DPKSQYSGVISKMFDSFEHNKPFTFFGDGLQTRDFVYVYDVVQSVRLIMEHKDAIGHGYN
IGTGTFTNLLEVYRIIGELYGKSVEHEFKEARKGDIKHSYADISNLKALGFVPKYTVETG
LKDYFNFEVDNIEEVTAKEVEMS
NT seq 972 nt   +upstreamnt  +downstreamnt
ttggaaagagttttgataactggtggggctggttttattgggtcgcatttagtagatgat
ttacaacaagattatgatgtttatgttctagataactatagaacaggtaaacgagaaaat
attaaaagtttggctgacgatcatgtgtttgaattagatattcgtgaatatgatgcagtt
gaacaaatcatgaagacatatcaatttgattatgttattcatttagcagcattagttagt
gttgctgagtcggttgagaaacctatcttatctcaagaaataaacgtcgtagcaacatta
agattgttagaaatcattaaaaaatataataatcatataaaacgttttatctttgcttcg
tcagcagctgtttatggtgatcttcctgatttgcctaaaagtgatcaatcattaatctta
ccattatcaccatatgcaatagataaatattacggcgaacggacgacattaaattattgt
tcgttatataacataccaacagcggttgttaaattttttaatgtatttgggccaagacag
gatcctaagtcacaatattcaggtgtgatttcaaagatgttcgattcatttgagcataac
aagccatttacattttttggtgacggactgcaaactagagattttgtatatgtatatgat
gttgttcaatctgtacgcttaattatggaacacaaagatgcaattggacacggttataac
attggtacaggcacttttactaatttattagaggtttatcgtattattggtgaattatat
ggaaaatcagtcgagcatgaatttaaagaagcacgaaaaggagatattaagcattcttat
gcagatatttctaacttaaaggcattaggatttgttcctaaatatacagtagaaacaggt
ttaaaggattactttaattttgaggtagataatattgaagaagttacagctaaagaagtg
gaaatgtcgtga

DBGET integrated database retrieval system