KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL0153
Entry
SACOL0153         CDS       T00225                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09790  uncharacterized protein
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Brite
KEGG Orthology (KO) [BR:sac00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SACOL0153
SSDB
Motif
Pfam: DUF454 Glyoxalase_2
Other DBs
NCBI-ProteinID: AAW37450
UniProt: A0A0H2WXF4
Position
complement(170371..170754)
AA seq 127 aa
MRLILIVIGLIFTALGIAGAVLPLLPTTPFLLVAVFCFARSSDRFYNWLINQKIYKEYVE
NFYLHRGYTLQQKIKILISLYIVIGFSIYMVDVLAVRVGLIIMVIIQTAVLFTFVKTLPK
SNHKIEE
NT seq 384 nt   +upstreamnt  +downstreamnt
atgcgacttattttaatcgtcattggcttaatatttacagcgcttggtattgcaggtgcc
gtattacctttactgccaacgaccccttttttactcgtagcagttttttgttttgctcga
agttcagatcgcttttacaattggcttattaatcaaaaaatttataaagaatatgtagaa
aacttttatttacatcgaggctacacgctacaacagaaaattaaaattttaattagctta
tacattgtaataggtttttcaatttatatggtggatgttcttgcagtccgtgtaggatta
atcataatggttatcatacaaaccgctgtactctttacatttgtaaaaacattacccaaa
tcaaatcataaaatagaggagtga

DBGET integrated database retrieval system