KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL0235
Entry
SACOL0235         CDS       T00225                                 

Definition
(GenBank) hexitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00040  Pentose and glucuronate interconversions
sac00051  Fructose and mannose metabolism
sac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SACOL0235
   00051 Fructose and mannose metabolism
    SACOL0235
Enzymes [BR:sac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     SACOL0235
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C PrmA ADH_zinc_N_2 Methyltransf_25 Methyltransf_31 2-Hacid_dh_C UDPG_MGDP_dh_N DUF4179
Other DBs
NCBI-ProteinID: AAW38790
UniProt: A0A0H2X040
Position
272268..273311
AA seq 347 aa
MKALKLYGVEDLRYEDNEKPVIESANDVIIKVRATGICGSDTSRYKKMGPYIKGMPFGHE
FSGVVDAIGSDVTHVNVGDKVTGCPAIPCYQCEYCLKGEYARCEKLFVIGSYEPGSFAEY
VKLPAQNVLKVPDNVDYIEAAMVEPSAVVAHGFYKSNIQPGMTVAVMGCGSIGLLAIQWA
RIFGAAHIIAIDIDAHKLDIATSLGAHQTINSKEENLEKFIENHYANQIDLAIESSGAKV
TIGQILTLPKKGGEVVLLGIPYDDIEIDRVHFEKILRNELTVCGSWNCLSSNFPGKEWTA
TLHYMKTKDINVKPIISHFLPLEKGPETFDKLVNKKERFDKVMFTIY
NT seq 1044 nt   +upstreamnt  +downstreamnt
gtgaaagcattgaaattatatggcgtggaagatttacggtatgaggataatgaaaagcca
gtcattgaaagtgcgaatgacgttattattaaagtacgagcgactggcatatgtggttca
gacacgtcacgatacaaaaaaatggggccatacattaaaggtatgccatttggtcatgaa
ttttcaggtgtagtagatgccattggaagtgatgttacgcatgttaatgtgggcgacaaa
gtgacaggttgcccagcaataccttgttatcaatgcgagtattgtttaaaaggtgaatat
gcacgatgtgaaaagttattcgtcattggctcatatgaacctggatcgttcgcggaatat
gtcaaattgccagcgcaaaatgttttaaaggttccagacaatgttgattacattgaagca
gcaatggttgagccatcagccgttgttgcgcatgggttttataaatcgaatatacaacct
ggtatgactgttgcagtaatggggtgtggcagtataggtttgttagctattcaatgggca
cgaatatttggtgctgcacatatcatcgctatagatatagatgcgcataaactagatatt
gcaacatcattgggcgcacatcaaacaatcaattcaaaagaagaaaatcttgagaaattc
atcgaaaatcattacgccaatcaaatcgatttagctatagaatcatcaggtgctaaagtt
acgattggtcaaatattgacgctacctaaaaaaggtggcgaggtggtattactcggaata
ccatatgatgatattgagattgatcgcgttcattttgaaaaaattctgcgtaacgagttg
acagtatgtggctcttggaactgtttgtccagtaattttccgggcaaagagtggacggca
accttacattatatgaagacgaaagatattaatgtaaagcctattatttctcatttttta
ccgttagaaaaaggcccggagacatttgataaattagttaacaagaaagaacgatttgat
aaagtcatgtttacgatttattag

DBGET integrated database retrieval system