KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL0321
Entry
SACOL0321         CDS       T00225                                 

Definition
(GenBank) prophage L54a, repressor protein, putative
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Motif
Pfam: Peptidase_S24 HTH_3 HTH_19 HTH_31 Pou HTH_26 HTH_37 MqsA_antitoxin
Other DBs
NCBI-ProteinID: AAW37528
UniProt: A0A0H2WXL9
Position
complement(357357..358076)
AA seq 239 aa
MDKKELAKFIGNKIRYYRTKLNLTQDQLGEKLNTKKATISNYETGYRTPKQDDLFEIAHI
LNISIDDLFPTRNNKKNDITSIYNKLTPPRQENVLNYANEQLDEQNKVTSIDEYKESKLV
SYIACGATGAGIGEELYDDILHEEVFFKEDETPSNADFCILVNGDSMEPMLKQGTYAFIK
KEDSIKDGTIALVVLDGVSLIKRVDICEDYINLVSLNPKYDDIKVASFSNIKVMGKVVL
NT seq 720 nt   +upstreamnt  +downstreamnt
atggataaaaaagaattagcgaaatttataggcaataaaatcagatactatagaaccaaa
ttgaacttaactcaagatcaacttggagaaaaactcaacactaaaaaagctactatttca
aattatgagacagggtacagaactcctaaacaagatgatttgtttgaaattgctcatatt
ttaaatatcagtatcgatgatttgtttcctacaagaaataataaaaaaaacgacatcact
tccatatacaacaaactcacacctccccgccaagaaaacgtacttaactacgcaaatgag
caattagatgaacagaataaagtcacttctatagatgaatataaagagtctaaactagta
tcgtatattgcatgtggtgcaactggtgctggcataggagaagaattatatgatgacata
ttgcatgaagaagtattttttaaagaagacgaaacgccatcaaatgctgatttttgtatt
ttagttaatggtgattcaatggaacctatgttaaaacaaggaacatacgcttttattaag
aaagaagattctattaaagatggtacaattgcactcgttgtattagatggagtaagtctt
atcaagcgtgtagatatatgcgaagactatattaatttggtatctctaaatccgaagtat
gatgatatcaaagtcgcttcgtttagtaatattaaagtaatgggcaaagttgtattgtga

DBGET integrated database retrieval system