KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL0323
Entry
SACOL0323         CDS       T00225                                 

Name
(GenBank) hypothetical protein
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
SSDB
Motif
Pfam: ATG17_like APG6_N DUF4164 Prefoldin_2 Trns_repr_metal
Other DBs
NCBI-ProteinID: AAW37530
UniProt: A0A0H2WXY4
Position
358451..358759
AA seq 102 aa
MQDQSLKLVKLQLKYHNLSGQIEAYDKSLKEIRYTRDLFNKHLSMNNEDAFAGLEMVEDE
ITKKLRSAIKEFQKVVKALDKLNGVESDNKVTDLTEWRKVNQ
NT seq 309 nt   +upstreamnt  +downstreamnt
atgcaagaccaatcattaaaattagtaaaactacaactaaaatatcataacctttcagga
caaattgaagcttatgataaatcacttaaagaaataagatacactcgagatcttttcaac
aaacatctaagcatgaataacgaagacgcatttgctggtttggaaatggtagaagatgaa
attactaaaaagctacgaagtgctatcaaagagttccaaaaagtagtgaaagcgttagac
aagcttaacggtgttgaaagcgataacaaagttactgatttaacagagtggcggaaagtg
aatcagtaa

DBGET integrated database retrieval system