KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL0336
Entry
SACOL0336         CDS       T00225                                 
Name
(GenBank) conserved hypothetical protein
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
SSDB
Motif
Pfam: DUF1108 RelB_leu_zip
Other DBs
NCBI-ProteinID: AAW37543
UniProt: A0A0H2WXN5
Position
362544..362804
AA seq 86 aa
MYYKAGEIKNKIINFNGFEFKVSAMKRHDGISIQVKDMNNVPLKSFHVVDLSELYIAMDA
MHDVINEWIEENTDEQDRLINLVMKW
NT seq 261 nt   +upstreamnt  +downstreamnt
atgtattacaaagcgggtgagataaaaaataaaattataaactttaacgggttcgaattt
aaagtgtctgcgatgaagagacatgacggtatcagtatacaagttaaggatatgaataat
gttccacttaaatcatttcatgtcgtagatttaagcgaactatatattgcaatggatgca
atgcacgacgttataaacgaatggattgaagagaacacagatgaacaggacagactaatt
aacttagtcatgaaatggtag

DBGET integrated database retrieval system