KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL0343
Entry
SACOL0343         CDS       T00225                                 
Name
(GenBank) prophage L54a, replicative DNA helicase, putative
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
SSDB
Motif
Pfam: DnaB_C AAA_25 DnaB
Other DBs
NCBI-ProteinID: AAW37550
UniProt: A0A0H2WYA4
Position
365904..367145
AA seq 413 aa
MNYGQFEIESTIIATLLKQPDVLEKIRVKDYMFTNEKFKTFFNYVMDVGKIDHQEIYLKA
TKDKEFLDADTITKLYNSDFIGYGFFERYQQELLESYQLNKANELVTEFKQQPTNQNFNN
LIDELKDLKTITNKKEDGTKKFVEEFVEELYSDSPKKQIKTGYKLMDYKIGGLEPSQLIV
IAARPSVGKTGFALNMMLNIAQNGYKTSFFSLETTGTSVLKRMLSTITGIELTKIKEIRN
LTPDDLTKLTNAMDKIMKLGIDISDKSNITPQDVRAQAMRHSDGQQVIFIDYLQLMDTDA
KVDRRVAVEKISRDLKIIANETGAIIVLLSQLNRGVESRQDKRPMLSDMKESGGIEADAS
LAMLLYRDDYYNRDEDDSITGKSIVECNIAKNKDGETGIIEFEYYKKTQRFFT
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgaattatggacaatttgaaattgaaagcacaataatcgctacgctgctcaaacaaccg
gacgtactagaaaagatacgagttaaagattatatgtttacgaacgaaaagtttaaaacc
tttttcaattatgtaatggacgtcggaaagatagatcatcaagaaatttatttaaaagca
actaaagataaagaatttttagatgcagatactataactaaactttataactccgatttc
attggatacggtttctttgaacgttatcaacaagaattattggaaagttatcaactcaac
aaagctaacgaattggtaactgagttcaaacaacaacctacgaatcaaaactttaacaac
ttgattgatgaactcaaggatttaaaaacgattactaacaaaaaagaagatggaaccaag
aagtttgttgaggagtttgtcgaagagttatacagcgatagccctaagaagcaaattaag
acgggttacaagctaatggattacaaaatagggggattagagccatcacaattaatcgtc
atcgcagcgcgtccctcagtgggtaagacaggctttgcattaaacatgatgctgaacata
gcacaaaatggatacaaaacatctttctttagtctcgaaacaaccggcacatcggtattg
aaacgtatgttatcaacaattactggtattgagttaacaaagataaaagaaatcaggaac
ttaacgccggatgacttaacaaagttaacgaatgcgatggataaaatcatgaaattaggc
atcgatatttctgataaaagtaatatcacaccgcaagatgtgcgagcgcaagcaatgagg
cattcagacgggcaacaagttatttttatagattaccttcaactgatggatactgatgcg
aaagttgatagacgtgtagcagtagaaaagatatcacgcgacttaaagataatcgctaac
gagacaggcgcaatcattgtactactttcacaactgaatcgtggagtcgagtctaggcag
gataaacgaccaatgctatcggacatgaaagaatcaggcggaatagaggcagatgcgagt
ttagcaatgctactttaccgtgatgattattataaccgtgacgaagatgacagtatcaca
ggcaaatctattgttgaatgtaacatagccaaaaacaaagacggcgaaaccggaataatt
gaattcgagtattacaagaagacgcagaggtttttcacatga

DBGET integrated database retrieval system