KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL0371
Entry
SACOL0371         CDS       T00225                                 

Definition
(GenBank) prophage L54a, DNA packaging protein, putative
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
SSDB
Motif
Pfam: Phage_connect_1
Other DBs
NCBI-ProteinID: AAW37578
UniProt: A0A0H2WXU3
Position
379162..379440
AA seq 92 aa
MSLEEIKLWLRIDYNFENDLIEGLIQSAKSELLLSGVPDYDKDDLEYPLFCTAIKYIIAR
DYESRGYSNDQSRSKVFNEKGLQKMILKLKKW
NT seq 279 nt   +upstreamnt  +downstreamnt
atgagtttagaagaaattaaattgtggttgagaattgactataatttcgaaaatgattta
attgaaggtctcattcaatcggctaagtctgaattactattaagtggggttccagattat
gacaaagatgacttggaatacccgcttttttgtacagcgattaaatatatcattgcaaga
gattatgaaagtcgtggatactcaaatgaccaatctagaagcaaggtgtttaatgaaaaa
ggattgcaaaaaatgattttgaaattaaaaaagtggtag

DBGET integrated database retrieval system