KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL0388
Entry
SACOL0388         CDS       T00225                                 

Definition
(GenBank) prophage L54a, holin, SPP1 family
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Motif
Pfam: Holin_SPP1 Turandot DUF3783
Other DBs
NCBI-ProteinID: AAW38857
UniProt: A0A0H2X0E3
Position
395748..396050
AA seq 100 aa
MDAKVITRYIVLILALVNQFLANKGISPIPVDEESVSSIILTVVALYTTYKDNPTSQEGK
WANQKLKKYKAESKYRKATGQAPIKEVMTPTNMNDTNDLG
NT seq 303 nt   +upstreamnt  +downstreamnt
atggatgcaaaagtaataacaagatacatcgtattgatcttagcattagtaaatcaattc
ttagcgaataaaggtataagtccgataccagtagatgaagaaagtgtttcatcgattatc
ttaacagttgttgctttatatactacatataaagataatccaacatctcaagaagggaaa
tgggcgaatcaaaaattaaagaaatataaagctgaaagtaaatatagaaaagcaacagga
caagcacctattaaagaagtaatgacacctacgaatatgaacgacacaaatgatttaggg
tag

DBGET integrated database retrieval system