KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL0728
Entry
SACOL0728         CDS       T00225                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09705  uncharacterized protein
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Brite
KEGG Orthology (KO) [BR:sac00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SACOL0728
SSDB
Motif
Pfam: Cupin_5
Other DBs
NCBI-ProteinID: AAW37791
UniProt: A0A0H2WY74
Position
753992..754465
AA seq 157 aa
MKSAEQWIDELQLESHPEGGFYRETIREVLKDGRRAPFSSIYFLLTDDNISHFHRIDADE
VWYYHAGDSLTIHMINPDGEYTTATLGTDIQNGDVLQYVVPKGTIFASSIEISNTFSLVG
CMCQPAFEFKQFELFKQSELITQYPHLKSVIEKYALK
NT seq 474 nt   +upstreamnt  +downstreamnt
atgaaatcagcagaacaatggattgatgaattgcaacttgaatcacatcctgaaggtggt
ttctatagagagacaattcgagaagtattgaaagatggacgcagagcgccgtttagtagt
atttattttttacttacagatgacaatatttcgcattttcatcgaattgatgctgatgaa
gtatggtactatcatgctggcgattctctaacaattcatatgataaatccggatggggaa
tatacgactgcaacattgggtactgatatccaaaatggagatgtattgcaatatgtagtg
cctaaaggaacaatttttgcttcttcaatcgaaatatcaaatacttttagtttagtaggt
tgtatgtgtcaaccggcatttgagtttaagcagtttgaattgtttaagcaatctgaatta
attacgcaatatccgcatcttaaatcagtaatcgaaaaatatgctttaaaataa

DBGET integrated database retrieval system