KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL1055
Entry
SACOL1055         CDS       T00225                                 

Symbol
sspC
Name
(GenBank) sspC protein
  KO
K23597  staphostatin B
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Brite
KEGG Orthology (KO) [BR:sac00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sac01002]
    SACOL1055 (sspC)
Peptidases and inhibitors [BR:sac01002]
 Peptidase inhibitors
  Family I57: staphostatin B family
   SACOL1055 (sspC)
SSDB
Motif
Pfam: Staphostatin_B Staphostatin_A
Other DBs
NCBI-ProteinID: AAW36520
UniProt: Q5HH37
Structure
PDB: 
1NYC 1QWX 1PXV 1Y4H

Position
complement(1061386..1061715)
AA seq 109 aa
MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDT
AHQRIKFSSIDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV
NT seq 330 nt   +upstreamnt  +downstreamnt
atgtatcaactacaatttataaatttagtttacgacacaaccaaactcacacatctagaa
caaaccaatatcaatttattcattggtaattggagtaatcatcaattacaaaaatcaatt
tgtatacgtcatggcgatgatacaagtcacaatcaatatcatattctttttatagatacg
gcacatcaacgcattaaattttcatctattgataatgaagaaatcatttatattcttgat
tatgatgatacacagcatatcctcatgcaaacgtcatccaaacaaggtattggcacttcg
cgaccaatcgtttatgagcgcttagtataa

DBGET integrated database retrieval system