KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL1058
Entry
SACOL1058         CDS       T00225                                 

Name
(GenBank) aminotransferase, class I
  KO
K00841  aminotransferase [EC:2.6.1.-]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00300  Lysine biosynthesis
sac01100  Metabolic pathways
sac01110  Biosynthesis of secondary metabolites
sac01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    SACOL1058
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sac01007]
    SACOL1058
Enzymes [BR:sac01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     SACOL1058
Amino acid related enzymes [BR:sac01007]
 Aminotransferase (transaminase)
  Class I
   SACOL1058
SSDB
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_5 OKR_DC_1
Other DBs
NCBI-ProteinID: AAW36523
UniProt: A0A0H2WWW6
Position
complement(1064554..1065708)
AA seq 384 aa
MKLSLNSNSKYLRAPSIRQFSNRMNNLDDCVNLTIGQPDFPMPDVVKKAYIDAINNDKTS
YSHNKGLLETREAISQYFKNRYHFSYDPEEIIVTNGASEAIDTTLRSIIEPGDEIIIPGP
IYAGYIPLIEVLGGKPIYIDTTATQFKITPDALESHISPKTKAVLLNYPTNPTGVVLKRN
EVLNIVNVLKKYPLFIISDEIYAENTFSGKHVSFAEFEDIRDQLILIGGLSKSHSATGIR
IGFLLGPQYLIDKLTFMHAYNCICANVPAQIACITALNEGLEAPKYMNEAYVERRNYLVS
ELTKLGFEITAQPEGAFYIFPSIKHITDDDFEFCVDLLESTHLAIVPGSSFTEFGKGFVR
ISYAYEMDVLKEGMKRLAKYLNTK
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgaaactttctttaaattctaattctaaatatttaagagcaccaagtattcgccaattt
tcaaatcgtatgaataatttggatgattgtgttaatttaactattggccaaccagacttc
ccgatgcctgatgttgtgaaaaaggcatatattgatgctattaacaatgacaagacatca
tactctcacaataaagggttattagaaactcgcgaagcaattagtcaatacttcaaaaat
cgttatcatttttcctatgatcctgaagaaattattgtgacaaatggagcaagtgaagca
atagacacaacgttacgttctatcatagagcctggagatgaaattataataccgggacca
atttatgcaggctacataccactcatcgaagtactaggtggtaaaccaatttatattgat
acaacagcaacacaatttaaaattacacctgatgcattagaaagtcatatttctccaaag
acaaaagctgtcttgttaaattatccgactaatccaactggcgtagttttaaaaagaaat
gaagttttaaatatcgtaaatgtattaaaaaaatatccgttatttattattagcgatgag
atttatgctgaaaatacatttagtggtaaacatgtatccttcgctgaatttgaagacatt
cgtgatcaattaatattaattggtggtttaagtaaatcacactcagcaaccggaataaga
attggttttctattaggacctcaatatttgattgataaattaacatttatgcacgcctat
aattgtatttgtgccaatgttccagctcaaatagcatgtataacagcacttaacgaagga
ttagaagctcctaaatatatgaacgaagcttatgtagaacgaagaaattatttagtatct
gaattaactaaattaggttttgagattaccgctcaacctgaaggcgcgttttatattttc
ccaagtattaaacatatcaccgatgacgatttcgaattttgtgtcgatttacttgaatca
acacatttagcaatcgttccaggctcatcctttacagaattcggtaaaggatttgtaagg
atttcctatgcttatgaaatggatgttttaaaagaaggtatgaagagacttgctaaatat
ttaaatactaaataa

DBGET integrated database retrieval system