KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL1178
Entry
SACOL1178         CDS       T00225                                 

Name
(GenBank) exotoxin 1, putative
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
SSDB
Motif
Pfam: SSL_OB Stap_Strp_tox_C
Other DBs
NCBI-ProteinID: AAW36557
UniProt: A0A0H2WVV6
Position
complement(1182590..1183306)
AA seq 238 aa
MSKNITKNIILTTTLLLLGTVLPQNQKPVFSFYSEAKAYSIGQDETNINELIKYYTQPHF
SFSNKWLYQYDNGNIYVELKRYSWSAHISLWGAESWGNINQLKDRYVDVFGLKDKDTDQL
WWSYRETFTGGVTPAAKPSDKTYNLFVQYKDKLQTIIGAHKIYQGNKPVLTLKEIDFRAR
EALIKNKILYNENRNKGKLKITGGGNNYTIDLSKRLHSDLANVYVKNPNKITVDVLFD
NT seq 717 nt   +upstreamnt  +downstreamnt
atgagtaagaacatcacgaaaaatataattttaacgacaacattattactattaggtact
gtattacctcaaaatcaaaaaccagtatttagtttttactctgaagctaaagcttatagc
attggtcaagatgaaactaacatcaatgaattaattaaatattacacacagcctcatttt
tcattttcaaataaatggctatatcaatatgataatggaaacatttatgttgaacttaag
agatattcatggtcagcacatatatctttatggggcgctgaaagttggggaaatattaat
cagttaaaagatcgttacgtagatgtgtttggactaaaagacaaagatactgatcagtta
tggtggtcttatagagagacatttacaggtggcgttacaccagccgcaaaaccttctgat
aaaacttataatctttttgtgcaatacaaagataaactacaaacgattattggtgcgcat
aaaatataccaaggcaataaaccagtattaacattgaaagaaatcgatttccgtgcacga
gaagcgttaataaaaaataaaatattatataacgaaaatcgtaataaaggtaagcttaag
atcaccggtggcggtaataactacactattgatttaagcaaaagattacattcagatcta
gcaaatgtttatgttaaaaatcctaataaaataactgttgacgtcctctttgattag

DBGET integrated database retrieval system