KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL1680
Entry
SACOL1680         CDS       T00225                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
SSDB
Motif
Pfam: CsbD TBCA Etd1 MT0933_antitox DUF6353
Other DBs
NCBI-ProteinID: AAW36787
UniProt: Q5HFD7
Position
complement(1709810..1709992)
AA seq 60 aa
MADESKFDQFKGNVKETVGNVTDNKELEKEGQQDKVIGKAKEVVENAKNKITDAIDKLKK
NT seq 183 nt   +upstreamnt  +downstreamnt
atggcagacgaaagtaagttcgatcaatttaaaggaaatgttaaagaaacagtaggtaac
gttactgataacaaagaattagaaaaagaaggtcagcaagataaagtgattggtaaagca
aaagaagttgttgaaaatgctaaaaacaaaataactgatgcaattgataaacttaaaaaa
taa

DBGET integrated database retrieval system