KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2197
Entry
SACOL2197         CDS       T00225                                 

Name
(GenBank) surface protein, putative
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
SSDB
Motif
Pfam: MAP
Other DBs
NCBI-ProteinID: AAW37073
UniProt: A0A0H2WXQ5
Structure
PDB: 
1YN4

Position
2278883..2279308
AA seq 141 aa
MKLKSFVTATLALGLLSTVGAALPSHEASADSNNGYKEMTVDGYHTVPYTISVDGITALH
RTYFIFPENKNVLYQEIDSKVKNELASQRGVTTEKINNAQTATYTLTLNDGNKKVVNLKK
NDDAKNSIDPSTIKQIQIVVK
NT seq 426 nt   +upstreamnt  +downstreamnt
atgaaactaaaatcatttgttactgccactttagcattgggattattatcaacggtcgga
gctgcattaccgagtcacgaagcatctgcagatagtaataacggctataaagaaatgact
gtggatggttatcacactgttccttacacaatttcagtagatggtattactgcattacat
cgaacttactttatcttcccagaaaataaaaatgttctttatcaagaaattgacagtaaa
gtaaaaaatgaattagcttctcaacgtggtgttacaacagaaaaaattaataatgcccaa
acagcaacttatacgcttactttgaatgatggtaataaaaaagtagtgaatctaaagaaa
aatgacgacgctaaaaattcaattgatccaagtacaatcaaacagatacaaattgtagtt
aaataa

DBGET integrated database retrieval system