KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2264
Entry
SACOL2264         CDS       T00225                                 

Gene name
moaE
Definition
(GenBank) molybdenum cofactor biosynthesis protein E
  KO
K03635  molybdopterin synthase catalytic subunit [EC:2.8.1.12]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00790  Folate biosynthesis
sac01100  Metabolic pathways
sac01240  Biosynthesis of cofactors
sac04122  Sulfur relay system
Module
sac_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:sac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SACOL2264 (moaE)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SACOL2264 (moaE)
Enzymes [BR:sac01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     SACOL2264 (moaE)
SSDB
Motif
Pfam: MoaE AhpC-TSA
Other DBs
NCBI-ProteinID: AAW37136
UniProt: Q5HDT6
Structure
PDB: 
2Q5W 2QIE

Position
complement(2327278..2327724)
AA seq 148 aa
MKQFEIVTEPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKL
AQIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVP
IWKKEIWEDGSKWQGHQKGNYEEAKREE
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaaacaatttgaaatcgtgacagaaccgatacaaacagaacaatatcgtgaattcact
ataaatgaatatcaaggtgcagtagttgtttttaccggtcatgttcgcgaatggactaaa
ggcgtcaaaacggaatatttagaatatgaagcgtatattccaatggctgaaaagaaattg
gcacaaattggagatgaaataaatgaaaaatggcctggaacgataacgagtattgttcat
agaatagggccattacaaatttcagatatcgctgtattaattgcggtttcttcaccgcat
cgtaaagatgcctatcgagcaaatgaatatgcaattgagcgtataaaagaaattgttccg
atttggaaaaaagaaatttgggaagatggttcaaaatggcaagggcatcaaaaagggaat
tatgaagaagcgaagagggaggaataa

DBGET integrated database retrieval system