KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2343
Entry
SACOL2343         CDS       T00225                                 
Name
(GenBank) conserved hypothetical protein
  KO
K07107  acyl-CoA thioester hydrolase [EC:3.1.2.-]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Brite
KEGG Orthology (KO) [BR:sac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SACOL2343
Enzymes [BR:sac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-
     SACOL2343
SSDB
Motif
Pfam: 4HBT_2 4HBT
Other DBs
NCBI-ProteinID: AAW37171
UniProt: A0A0H2WWU5
Position
2403159..2403650
AA seq 163 aa
MVIIKQLFTHTQTVTSEFIDHNNHMHDANYNIIFSDVVNRFNYSHGLSLKERENLAYTLF
TLEEHTTYLSELSLGDVFTVTLYIYDYDYKRLHLFLTLTKEDGTLASTNEVMMMGINQHT
RRSDAFPESFSTQIAHYYKNQSTITWPEQLGHKIAIPHKGALK
NT seq 492 nt   +upstreamnt  +downstreamnt
atggttattatcaaacaactttttacacatactcaaaccgtaacatctgaattcattgac
cataacaatcatatgcatgatgcaaattataatatcatttttagtgacgtcgtgaatcgt
tttaattacagccacggtctttctttaaaagaacgcgaaaatttagcatatacgctattt
acactagaagaacatacgacatacctctcagaattgtctcttggcgatgtatttactgtt
actttatatatttatgattacgattataagcggttgcatttatttttaacattaactaaa
gaagatggtacactagcatcaacaaatgaagtaatgatgatgggaattaatcagcacaca
cgtcgttctgatgcttttcctgaatcattttcaacacaaatagcacactattataaaaat
caatcaactatcacttggcctgaacaattaggacataaaatagcaattccacacaaagga
gcattaaaatga

DBGET integrated database retrieval system