KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2344
Entry
SACOL2344         CDS       T00225                                 
Name
(GenBank) hypothetical protein
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
SSDB
Motif
Pfam: PRP9_N DUF3567 LMP COOH-NH2_lig MSP7_C
Other DBs
NCBI-ProteinID: AAW37172
UniProt: A0A0H2WXI1
Position
2403647..2404066
AA seq 139 aa
MTDALQQKIHIELLDLLDDVKFELTELNAQKGLYINGPANQLLKRGVHMAYVQGQKQAID
NIMTIVEQQLEDQHFLEHYDKFQNEVAHRNYDKTANFAELSDIPRQFDNFLDQFYQIKGQ
YFIITHINTLIGDFHSEAH
NT seq 420 nt   +upstreamnt  +downstreamnt
atgacagatgcattacaacaaaagattcatatcgaattactagatttattagatgatgtt
aagtttgaattaacagaattaaatgcacaaaaagggttatacattaacggaccagcaaat
cagctacttaagcgtggcgtgcatatggcttatgttcaaggacaaaagcaagccatcgat
aatattatgactattgtggaacaacagcttgaagatcaacatttcctagaacattatgat
aaatttcaaaatgaggttgctcatcgcaattatgataaaacagctaactttgcagaactt
agtgatattccacgtcaattcgataattttttagatcaattttatcaaattaaagggcaa
tactttatcatcacacatatcaatacacttattggtgattttcactcagaagctcattaa

DBGET integrated database retrieval system