KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2346
Entry
SACOL2346         CDS       T00225                                 
Name
(GenBank) conserved hypothetical protein
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
SSDB
Motif
Pfam: UCH_N
Other DBs
NCBI-ProteinID: AAW37174
UniProt: A0A0H2WXV5
Position
2405302..2405940
AA seq 212 aa
MTNPNQRLEPFDETFQQPNIHRGKRYGKKKRSLVSMIIQIIVVILTAIAGYSMWKQPIFN
IVFTKESVDFDGIKNFNETIGKMHQLNINLGNINDLQQGIDRLILVFNGFFILCIVSLVI
TILTIVFNRTVLKVVNILVLTIMLVITLYFSYIIKALAQEIADVFKKYYLNVPPDQVITE
ADAIHNGIILLGCSIGLLVISLFFRNRMPRLK
NT seq 639 nt   +upstreamnt  +downstreamnt
atgacaaatccaaatcaacgattagaaccatttgatgagacatttcaacaaccgaatatt
catcgtggtaagcgatatggtaagaaaaaacgttcattggtaagcatgattattcaaatc
attgttgttatattaaccgcaatcgctggatacagcatgtggaaacaacccatttttaat
attgtcttcaccaaagaatctgtagattttgatggcattaaaaattttaacgagacaatt
ggaaaaatgcatcaattaaatattaatttgggtaatatcaatgatttacaacaaggaatc
gatcgcttaattttagtctttaacggtttctttattttatgtatcgttagcctagtcata
acaatactgacaattgtatttaatcgcacagttctaaaagtagtaaatattttagtgtta
acaattatgttagtcattacattgtatttcagttatattattaaagcactcgcacaagaa
attgcagatgttttcaaaaaatattatttaaatgtaccaccagatcaagtgattacagaa
gctgacgctattcataacggcatcattttacttggctgtagcatcggtttacttgttata
agcttattcttccgtaatcgcatgcctcgtttaaaataa

DBGET integrated database retrieval system