KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2348
Entry
SACOL2348         CDS       T00225                                 
Name
(GenBank) drug transporter, putative
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
SSDB
Motif
Pfam: HlyD_3 HlyD_D23 Biotin_lipoyl_2 Biotin_lipoyl HlyD_2 CusB_dom_1 DUF6672 DUF2118 PASTA Peptidase_M23 DUF3221 SurA_N_3
Other DBs
NCBI-ProteinID: AAW37176
UniProt: A0A0H2WWV0
Position
complement(2408130..2408777)
AA seq 215 aa
MKKMILINVITVVVLLAIGIAGFYFWNKTTSYVTTDNAKVNGDQIKIASPASGQIKSLNV
KQGDKLDKGDKVAIVTVQGQDGETKDMDLKMPQKGTIAKLDGMEGSMVQAGNPIAYAYNL
DDLYVTANIDEKDIKDVEVGKDVDVTIDGQKASIKGKVDSIGKATAASFSLMPSSNSDGN
YTKVSQVIPVKITLESEPSKQVVPGMNAEVKIHKN
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaaaaagatgatattaattaatgtcattacggttgttgtactgttagcaattgggatt
gctggcttttatttttggaataaaacaacaagctatgtaacaactgataatgcaaaagta
aatggcgatcaaattaaaatagcaagtcctgcatctggacaaattaaatcacttaatgtt
aaacaaggtgacaaactcgataaaggtgacaaagtagcaattgttactgtacaaggtcaa
gatggcgaaacgaaagatatggatcttaaaatgcctcaaaaaggtacaattgccaaatta
gatggtatggaaggttcaatggtgcaagctggtaacccaatcgcttatgcatacaattta
gatgatttatatgtaacagcaaatattgacgaaaaagatattaaagatgttgaagtaggt
aaagatgttgatgtgactattgacggtcaaaaagcttctattaaaggtaaagttgatagt
attggaaaagcaactgctgcaagcttttcattaatgccatcatcaaatagtgatggtaac
tacactaaagtttctcaagtaatacctgttaaaatcactctagaatcagaaccgtctaaa
caagttgttcctggaatgaacgctgaagtaaaaatccataaaaattaa

DBGET integrated database retrieval system