KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2349
Entry
SACOL2349         CDS       T00225                                 
Name
(GenBank) transcriptional regulator, TetR family
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
SSDB
Motif
Pfam: TetR_C_8 TetR_N HTH_Tnp_1_2 HTH_23
Other DBs
NCBI-ProteinID: AAW37177
UniProt: A0A0H2WXI7
Position
2408898..2409449
AA seq 183 aa
MKRQAKIEIQNALVDLMAEYPFQEISTKMICAYCNINRSTFYDYYKDKFDLLDTINSKHK
EKFQFLLSALHHNFENIKQDKLKLYKFFIIIAKYIKHNEQFFKDILVTYPMKTLFIDYIN
LARDYYQQIMNDYSTTVTNKQLYVTYIIGGQAGVFINWLSNGCNESPEEVADILLANTIK
LQN
NT seq 552 nt   +upstreamnt  +downstreamnt
atgaaacgacaagccaaaatagaaattcaaaacgcacttgttgatttgatggctgaatat
ccttttcaagaaatatccactaaaatgatttgcgcgtattgtaatattaatcgttctact
ttttatgattattacaaagataaatttgatttattggataccatcaactcaaagcataag
gaaaaattccaatttcttctaagcgcgctacatcataatttcgaaaatattaaacaggat
aagcttaaactttataaattcttcattattattgctaagtatatcaagcacaatgagcag
tttttcaaagacattttagttacctatccaatgaaaacattattcatagactatataaat
ttagcgagagattactatcaacaaattatgaatgactatagtactacagtaaccaataaa
cagctttatgttacatatatcataggcggtcaagctggggtgtttattaattggctttcg
aatggttgtaatgaatcacctgaagaagttgctgacattttattggctaatacgattaaa
cttcaaaactaa

DBGET integrated database retrieval system