KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2350
Entry
SACOL2350         CDS       T00225                                 
Symbol
tcaB
Name
(GenBank) tcaB protein
  KO
K07552  MFS transporter, DHA1 family, multidrug resistance protein
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Brite
KEGG Orthology (KO) [BR:sac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sac02000]
    SACOL2350 (tcaB)
Transporters [BR:sac02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    SACOL2350 (tcaB)
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_3
Other DBs
NCBI-ProteinID: AAW37178
UniProt: A0A0H2WX36
Position
complement(2409679..2410887)
AA seq 402 aa
MNDLTHFNKRSPIFIIILGSLTAIGALSIDMFLPGLPDIRHDFQTTTSNAQLTLSMFMIG
LAFGNLFAGPISDSTGRRKPLIIAMIIFTLASLGIVFVHNIWLMVALRFLQGVTGGAAAV
ISRAIASDMYSGNELTKFMALLMLVNGIAPVVAPTIGGIILNYSVWRMVFVILTIFGFVM
VIGSLLKVPESLTVTNRESSSGLKTMFKNFKILLKTPRFVLPMLIQGMTFVILFTYISAS
PFIIQKIYGMTAIQFSWMFAGIGITLIISSQLTGYLVDFIDSQKLMRGMTMIQIIGVILV
TIVLLNHWNFWILAIGFIILIAPVTGVATLGFTIAMDESSSGRGSSSSLLGLVQFLFGGV
ASPLVGVKGEDNPIPYIIIIIATAVILIILQIYNMKVFKTNR
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgaatgatttaacgcattttaacaagcgttcaccgatatttattattattttaggatct
ttgacggccattggagcattatcgatagatatgtttttgcctggattaccagatattaga
catgattttcaaacaacgacgtctaacgcacaattaacattatcgatgtttatgattggt
ttagcgtttggtaatttgtttgctggtccaatttcagattcaactgggcgcagaaagccg
cttattatagctatgattatttttacattagcaagtttaggtattgtttttgtacataat
atttggctgatggttgcattaagatttcttcaaggagtgacaggtggcgcagcagcagtt
atttcaagagctatagcaagtgatatgtatagtggtaatgaactaactaagtttatggca
ttattgatgcttgttaatggtattgcaccagttgttgcgccaacaatagggggcataatt
ttaaattattctgtctggcgtatggtctttgtcattctgactatctttggcttcgtcatg
gtcataggttctttattaaaagtacctgaatcattaacagtgacaaatcgtgagtcaagt
agtggattaaagacaatgtttaaaaacttcaaaatattattgaagacgccacgttttgta
ttaccaatgctcattcaaggtatgacatttgtaatattatttacttatatttctgcgtct
ccgtttattattcaaaaaatttatggcatgactgcaatacaatttagttggatgtttgca
ggaattggtattacgctcattatatcaagtcaacttactgggtaccttgttgattttata
gactcacaaaaattgatgagaggcatgacgatgattcagattatcggtgtaattttagtg
acgattgtattgcttaatcattggaacttttggattttagcgataggatttatcatttta
atagcaccagtgacaggtgttgcgacacttggttttacaatagctatggatgaaagtagt
agtggtagagggagttcatcaagtttattaggtttagtacagtttttatttggtggtgtt
gcatcgccattagtgggggtaaaaggtgaagataatcctataccttacataattattatt
atagctacagcagttatattaattattttacagatttataatatgaaggtatttaaaaca
aatcgatga

DBGET integrated database retrieval system