KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2412
Entry
SACOL2412         CDS       T00225                                 

Definition
(GenBank) amino acid ABC transporter, amino acid-binding protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac02010  ABC transporters
sac02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:sac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SACOL2412
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    SACOL2412
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sac02000]
    SACOL2412
   02035 Bacterial motility proteins [BR:sac02035]
    SACOL2412
Transporters [BR:sac02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    SACOL2412
Bacterial motility proteins [BR:sac02035]
 Flagellar system
  Flagellar assembly proteins
   Others
    SACOL2412
SSDB
Motif
Pfam: SBP_bac_3 Phosphonate-bd Lig_chan-Glu_bd InPase NMT1 SspK
Other DBs
NCBI-ProteinID: AAW37237
UniProt: A0A0H2WX83
Position
complement(2471316..2472095)
AA seq 259 aa
MKRLLFVMIAFVFILAACGNNSSKDKEASKDSKTINVGTEGTYAPFSFHDKDGKLTGYDI
DVIKAVAKEEGLKLKFNETSWDSMFAGLDAGRFDVIANQVGINPDREKKYKFSKPYTFSS
AVLVIRENEKDIKDFDDVKGKKLAQTFTSNYGKLAKDKGADITKVDGFNQSMDLLLSKRV
DGTFNDSLSYLDYKKQKPNAKIKAIKGNAEQSRSAFAFSKKADDETVQKFNDGLKKIEEN
GELAKIGKKWFGQDVSKSK
NT seq 780 nt   +upstreamnt  +downstreamnt
atgaaaagacttttatttgtgatgatagctttcgttttcatattggctgcatgcggaaac
aattcgtcgaaagacaaggaagctagtaaagatagcaagacaattaatgttgggactgag
gggacttatgcaccatttagtttccacgataaagatggtaaattaactggttacgatatt
gatgttattaaagcagtggctaaagaagaaggtttaaaacttaaatttaatgaaacttct
tgggattctatgtttgcaggtttagacgcagggcgttttgatgtaatcgcgaaccaagta
ggtattaatcctgatagagaaaagaaatataaattttctaagccttacacattctcaagt
gctgttttagttattcgtgaaaatgaaaaagatattaaagattttgatgatgttaaaggt
aagaagttagcacaaacattcacatctaattatggtaaattagctaaggataaaggtgct
gatattacaaaagttgatggctttaaccaatcaatggatttattattgtctaagcgtgtt
gatggtacatttaatgatagtctgtcatacttggattataaaaaacaaaaacctaatgct
aagatcaaagcaatcaaaggtaatgctgaacaaagtagatctgcatttgcattttctaaa
aaagcagatgatgaaacagttcaaaaattcaatgatggcttgaaaaaaatcgaggaaaac
ggtgaattagctaaaataggtaagaaatggtttggtcaagatgtttctaaatctaaatag

DBGET integrated database retrieval system