KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2550
Entry
SACOL2550         CDS       T00225                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Motif
Pfam: Thioredoxin Thioredoxin_3 Cytochrom_C1 DUF5947 Ldh_1_C Phosducin Toxin-deaminase HyaE
Other DBs
NCBI-ProteinID: AAW37326
UniProt: A0A0H2WXH9
Position
complement(2607795..2608139)
AA seq 114 aa
MVKQLNSVEAFREFIHQYPLAVVHVMRDQCSVCHAVLPQIEDLMQSYPNVPLAVINQSQV
EAIAGELNIFTVPVDLIFMNGKEMHRQGRFIDMQRFEHHLKQMNDSVNNDVDEH
NT seq 345 nt   +upstreamnt  +downstreamnt
atggttaagcaattaaatagtgtcgaagcattccgtgaatttattcatcaatatccgtta
gcagttgtacatgtcatgcgcgatcagtgtagcgtgtgtcatgccgttttaccacaaatt
gaagacttgatgcaatcatatcccaatgtgccattagctgtgattaatcaaagtcaggtg
gaagctattgctggagaattaaatattttcactgtacctgtggatttaatttttatgaat
ggaaaagaaatgcatcgtcaagggcgttttatcgatatgcaacgttttgaacatcatctt
aagcaaatgaatgatagtgtaaataacgatgtcgatgagcattaa

DBGET integrated database retrieval system