KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2669
Entry
SACOL2669         CDS       T00225                                 

Name
(GenBank) conserved hypothetical protein
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
SSDB
Motif
Pfam: DUF6365
Other DBs
NCBI-ProteinID: AAW38667
UniProt: A0A0H2X0D2
Position
complement(2737448..2738806)
AA seq 452 aa
MIKLFDYFNDHSRKLYESFKASKLEEDLTIVLNDNGFLPDDVISPYQFFADNHNTENMKP
RFFNQVTVPAFWEIKGNNNSATINDMGRLRGKIFYQSGERPRIVSRVEWFDDQQRVRFVD
YYSKNGIKFAQTVYDLNRKAILKKYMTAEGKEVIYENFVTSDVILDWQGKSYFFPSKLAF
ALFFIKQLEITEHHFVINSLALPFSVLYNLPSKGSDVLVWQEHCNGNVPGNMQLMCKGDM
KRHCNIIIPDKNEYETMLNIADAKVQSRILQGGYLYNYRSRNRYTKEIVILTNSDQLRNI
KVLVETLPDFKFHIAAITEMSDKLMQLDQYANVHLYPSINIDRVNELYQLCDIYLDINEG
NEILNAVEQAFDYELLILGYRQTAHHAKVTLSEHLFEHNDEITMESKDQLIQMLESLKDQ
QQFRDALLAQKAHAHEISREQFEQVFKQALES
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgattaaattatttgattactttaacgatcattcacgaaagttatatgagtcttttaaa
gccagtaagttggaagaagatttaacaattgtactcaatgacaatggctttttaccggac
gatgttatatcaccgtatcaattttttgcagataatcataatacagaaaatatgaaacca
cgattttttaatcaggttactgtaccagctttttgggaaattaaaggtaacaacaattcg
gctacaattaatgatatgggacgtctacgaggtaaaatattttatcaaagtggagagcgc
cctagaattgttagtcgtgtcgaatggtttgatgaccaacaacgtgtccgatttgtcgat
tattattctaagaatggtattaaatttgcacaaactgtttacgatttaaatcgtaaagcg
atcttgaagaaatatatgacagcagaaggtaaagaagtgatttatgaaaattttgtaaca
tctgatgtcatattggattggcaagggaagtcttactttttcccttcaaagctcgcattc
gcattattttttatcaagcaacttgaaattacggaacatcatttcgttattaactcacta
gccctaccattttcagtgttatataatttgccatcaaaaggtagtgatgttttggtatgg
caagaacactgtaatggtaatgtcccgggaaatatgcaattgatgtgtaaaggtgatatg
aaacgacattgtaatattattattccagataaaaacgaatatgaaacgatgctcaatata
gcagacgcaaaggttcaatctcgtattttacaaggcggatatctatataactatcgtagt
cgtaatagatatactaaagaaattgtaatattaactaactcggatcaacttcgtaacatc
aaggtattggttgaaactttaccagattttaagtttcacatcgctgctattacagagatg
tctgataagctaatgcaacttgatcaatatgctaatgtgcatttatacccatctattaat
attgacagggtaaatgaactataccagttatgtgatatttatcttgatatcaatgagggt
aatgaaattttaaatgcggtggaacaagcgtttgactatgagttgttgattttaggttat
cgtcaaaccgcacaccatgctaaagtaacattatcagagcacttatttgagcataatgat
gagataacaatggaaagtaaagaccaattaatacaaatgttagaaagtttgaaagatcaa
caacagtttcgagatgctttattagcacaaaaagcacatgcacacgaaatctcgcgtgaa
caattcgagcaagtttttaaacaggcgctcgaaagctaa

DBGET integrated database retrieval system