KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2707
Entry
SACOL2707         CDS       T00225                                 

Name
(GenBank) cobalt transport family protein
  KO
K16785  energy-coupling factor transport system permease protein
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SACOL2707
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sac02000]
    SACOL2707
Transporters [BR:sac02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter
    SACOL2707
SSDB
Motif
Pfam: CbiQ DUF5762 PDR_CDR
Other DBs
NCBI-ProteinID: AAW37355
UniProt: A0A0H2WXX1
Position
complement(2779276..2780109)
AA seq 277 aa
MNQYNTIGFHPGNSRIHQLNATVKLLFLLVVSISAMVTYDTRYLILISASSILLVKYAHI
EWKQVRFVVKFILFFTILNIIAVYIFDPEYGVKIYNQRTELVNGIGRFTLTSQELFYLFN
LILKYISTVPLALIFLFTTNPSHFAASLNQLGVNYKISYAVSLALRYIPDIQETYFNISQ
AQQARGYDNSKKAKFTSRVKGIKRIVLPLIFSSIERIDTISTAMELRQFGQYKRRTWYVK
KQLKKDDYVVLCLTLILLMLVVTLFFLNNSRYFNPWH
NT seq 834 nt   +upstreamnt  +downstreamnt
atgaatcaatataatactataggttttcacccgggaaatagtcgtattcatcaattaaat
gcgactgttaaacttttattcttattagttgtttctatttctgcaatggtgacttatgac
acaagatatttaattttaattagtgcttcatctattttattggtcaaatatgctcatatt
gaatggaaacaagttcgctttgttgttaaattcattctgtttttcacaatattaaatatt
attgccgtgtacatatttgaccctgaatatggtgtgaagatttataatcagcgtacagag
ttagtcaatggtattggtcgatttacgctaacatcacaggaattattctatctttttaat
ctaatattaaaatatattagtacagttcctttagcgttaatatttttattcacaacgaat
ccgagtcattttgctgcaagtttaaatcagctaggtgtgaattataaaatcagttacgca
gtctcactagcattaaggtatattccagatattcaagaaacatattttaatatttcacaa
gcgcaacaagcaagaggatatgataattcgaaaaaagcaaaatttactagccgtgttaaa
ggtatcaaacgcattgtgttacctttaatattttctagtatcgaaagaattgacactatt
agtactgctatggagttaagacaattcggacagtataaaaggagaacctggtacgtcaaa
aaacaattaaaaaaagatgattatgttgttttgtgtttgacgttaatacttctgatgtta
gtagttacattattctttttaaataatagtcgatatttcaacccgtggcattag

DBGET integrated database retrieval system