KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL0412
Entry
SACOL0412         CDS       T00225                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
SSDB
Motif
Pfam: PSI_PsaE
Other DBs
NCBI-ProteinID: AAW38881
UniProt: A0A0H2X0F7
Position
418756..419052
AA seq 98 aa
MIGNLDINQSNRHYNAYWRGPNKEADEKSAYNNVQVGDGPQHREIGSVISTDNASWRGPN
IENFEKKFYKQCKLAGPQHREFRKEILQAMQVGEGQQI
NT seq 297 nt   +upstreamnt  +downstreamnt
gtgataggaaacttggacatcaatcaaagtaataggcactacaacgcttattggcggggc
cccaacaaagaagctgacgaaaagtcagcttacaataatgtgcaagttggggatgggccc
caacatagagaaattgggtccgtaatttctacagacaatgcaagttggcggggccccaac
atagagaatttcgaaaagaaattctacaagcaatgcaagttggcggggccccaacataga
gaatttcgaaaagaaattctacaagcaatgcaagttggggaaggacaacaaatttaa

DBGET integrated database retrieval system