KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL0426Help
Entry
SACOL0426         CDS       T00225                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00071  Fatty acid degradation
sac00072  Synthesis and degradation of ketone bodies
sac00280  Valine, leucine and isoleucine degradation
sac00310  Lysine degradation
sac00362  Benzoate degradation
sac00380  Tryptophan metabolism
sac00620  Pyruvate metabolism
sac00630  Glyoxylate and dicarboxylate metabolism
sac00640  Propanoate metabolism
sac00650  Butanoate metabolism
sac00900  Terpenoid backbone biosynthesis
sac01100  Metabolic pathways
sac01110  Biosynthesis of secondary metabolites
sac01120  Microbial metabolism in diverse environments
sac01130  Biosynthesis of antibiotics
sac01200  Carbon metabolism
sac01212  Fatty acid metabolism
sac02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SACOL0426
   00630 Glyoxylate and dicarboxylate metabolism
    SACOL0426
   00640 Propanoate metabolism
    SACOL0426
   00650 Butanoate metabolism
    SACOL0426
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SACOL0426
   00072 Synthesis and degradation of ketone bodies
    SACOL0426
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SACOL0426
   00310 Lysine degradation
    SACOL0426
   00380 Tryptophan metabolism
    SACOL0426
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SACOL0426
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SACOL0426
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SACOL0426
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sac04147]
    SACOL0426
Enzymes [BR:sac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SACOL0426
Exosome [BR:sac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SACOL0426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AAW38894
UniProt: Q5HIU0
Position
429930..431111
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEIDEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLAEQYGISREEQDTFAV
NSQQKAVRAQQNGEFDSEIVPVSIPQRKGEPIVVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattgatgaagttatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacggtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcaa
tcaccaatgcttgtcaacaacagtcgctttggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagcagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacaaaaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcgtagtcactaaggatgaaggtgta
cgtgaaaatgtatcagtcgaaaaattaagtcgattaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggtgtagatccttctattatgggtattgcaccagttggcgctgtagaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgttgatcgtgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacatcctattggtgcatctggtgctagagtattagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system