KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL0904
Entry
SACOL0904         CDS       T00225                                 

Definition
(GenBank) pathogenicity island protein
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
SSDB
Motif
Pfam: PSDC IZUMO
Other DBs
NCBI-ProteinID: AAW37874
UniProt: A0A0H2WYC2
Position
914733..915260
AA seq 175 aa
MKLLKTKNCLYYRNGDNKLSEYQLLTQFNPAFINKKIKMCEFQIESMYHMSASTTTCDEI
MGVVSVSYPIEKLVIKIIETKAGLQNYKNRSINNMALLKKVLNHYTEKEQKQVVKYMRSN
GRYKPYNVIERLQVDLYQASIKQRSERQKQRNTAIENSKIARVNAYHQSSYVKVV
NT seq 528 nt   +upstreamnt  +downstreamnt
atgaaactgcttaaaacgaagaattgtttatattatcgtaatggcgacaataaactatct
gagtatcaactattaacgcaatttaacccagcatttattaataaaaaaattaagatgtgt
gaattccaaattgaaagtatgtaccatatgagtgcgtcgaccacaacatgtgatgaaata
atgggggtcgtgtctgtctcatatccgattgaaaaattagttatcaaaattattgaaaca
aaagcagggttacaaaactataaaaatagatctataaataatatggcgttgttgaaaaag
gtactaaatcattatacagaaaaagagcagaagcaagttgtaaaatatatgcgttcaaat
ggacgatataagccctacaacgtcattgaacgcttacaagttgatttgtatcaagcaagt
attaaacaacgttcagaacgtcaaaaacaaagaaatacagcaattgaaaacagtaagatt
gcacgagtaaatgcatatcaccaatcttcatatgtaaaagtggtgtaa

DBGET integrated database retrieval system