KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL1123Help
Entry
SACOL1123         CDS       T00225                                 

Gene name
pyc
Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00020  Citrate cycle (TCA cycle)
sac00620  Pyruvate metabolism
sac01100  Metabolic pathways
sac01120  Microbial metabolism in diverse environments
sac01200  Carbon metabolism
sac01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SACOL1123 (pyc)
   00620 Pyruvate metabolism
    SACOL1123 (pyc)
Enzymes [BR:sac01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     SACOL1123 (pyc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl ATP-grasp Biotin_lipoyl_2 Dala_Dala_lig_C ATP-grasp_3 HlyD_D23 HlyD_3 RimK ATP-grasp_4 GARS_A RnfC_N ATPgrasp_Ter GCV_H
Motif
Other DBs
NCBI-ProteinID: AAW38003
UniProt: A0A0H2WZK5
Structure
PDB: 

Position
1132473..1135925
Genome map
AA seq 1150 aa AA seqDB search
MKQIKKLLVANRGEIAIRIFRAAAELDISTVAIYSNEDKSSLHRYKADESYLVGSDLGPA
ESYLNIERIIDVAKQANVDAIHPGYGFLSENEQFARRCAEEGIKFIGPHLEHLDMFGDKV
KARTTAIKADLPVIPGTDGPIKSYELAKEFAEEAGFPLMIKATSGGGGKGMRIVREESEL
EDAFHRAKSEAEKSFGNSEVYIERYIDNPKHIEVQVIGDEHGNIVHLFERDCSVQRRHQK
VVEVAPSVGLSSTLRQRICDAAIQLMENIKYVNAGTVEFLVSGDEFFFIEVNPRVQVEHT
ITEMVTGIDIVKTQILVAAGADLFGEEINMPQQKDITTLGYAIQCRITTEDPLNDFMPDT
GTIIAYRSSGGFGVRLDAGDGFQGAEISPYYDSLLVKLSTHAISFKQAEEKMVRSLREMR
IRGVKTNIPFLINVMKNKKFTSGDYTTKFIEETPELFDIQPSLDRGTKTLEYIGNVTING
FPNVEKRPKPDYELASIPTVSSSKIASFSGTKQLLDEVGPKGVAEWVKKQDDVLLTDTTF
RDAHQSLLATRVRTKDMINIASKTADVFKDGFSLEMWGGATFDVAYNFLKENPWERLERL
RKAIPNVLFQMLLRASNAVGYKNYPDNVIHKFVQESAKAGIDVFRIFDSLNWVDQMKVAN
EAVQEAGKISEGTICYTGDILNPERSNIYTLEYYVKLAKELEREGFHILAIKDMAGLLKP
KAAYELIGELKSAVDLPIHLHTHDTSGNGLLTYKQAIDAGVDIIDTAVASMSGLTSQPSA
NSLYYALNGFPRHLRTDIEGMESLSHYWSTVRTYYSDFESDIKSPNTEIYQHEMPGGQYS
NLSQQAKSLGLGERFDEVKDMYRRVNFLFGDIVKVTPSSKVVGDMALYMVQNDLDEQSVI
TDGYKLDFPESVVSFFKGEIGQPVNGFNKDLQAVILKGQEALTARPGEYLEPVDFEKVRE
LLEEEQQGPVTEQDIISYVLYPKVYEQYIQTRNQYGNLSLLDTPTFFFGMRNGETVEIEI
DKGKRLIIKLETISEPDENGNRTIYYAMNGQARRIYIKDENVHTNANVKPKADKSNPSHI
GAQMPGSVTEVKVSVGETVKANQPLLITEAMKMETTIQAPFDGVIKQVTVNNGDTIATGD
LLIEIEKATD
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacaaataaaaaagttacttgttgctaaccgtggagaaattgcaattcgtatattc
agagcggcggcagaattagacatcagcacagttgcaatttattcgaatgaagacaaaagt
tcattacatagatataaagcagatgaatcctatttagttggaagtgatttaggtcctgct
gaaagttatttaaatattgagcgtatcattgatgtagcaaaacaagcgaatgtggatgcg
attcatcctggctatggatttttaagtgaaaatgaacaatttgcgcgtcgttgtgcagaa
gaaggaattaaatttattggtcctcatttagaacatttagatatgtttggagataaagtt
aaagctcgtacaacggctatcaaggcagatttaccagttattcctggtacagacggtcca
attaaatcatatgaattagcaaaagaatttgcagaagaagctggtttcccgctaatgatt
aaagccacaagtggtggcggcggtaaaggtatgagaatcgttcgtgaagaaagtgaatta
gaagatgctttccatagagcaaaatcagaagctgaaaaatcatttggtaatagtgaagtt
tacatagaaagatacattgataatccaaagcatattgaagtacaagtcataggtgacgaa
catggaaatatcgtacacttatttgaacgtgattgttcagtacaacgtcgtcatcaaaaa
gttgtagaagttgcaccatcagttggattatcatcaacattacgtcaacgtatttgtgat
gctgcaattcaattgatggaaaatattaaatatgtcaatgcaggtactgttgaatttcta
gtatctggtgacgaattcttctttatagaagttaaccctcgtgtacaagtagagcataca
attacagagatggtaacaggaattgatattgttaagacacaaattttagttgcagcaggt
gccgatttatttggtgaagagattaatatgccgcaacaaaaagatattacaacattaggc
tatgccatccaatgtcgtattacaacagaagatccgttaaatgatttcatgccggatact
ggaacaatcattgcttatcgttcaagcgggggctttggtgtacgtcttgatgctggagat
ggtttccaaggtgctgagatatcaccttattatgattcattactcgtaaaattatctaca
cacgcgatatcatttaaacaagcagaagaaaaaatggtacgctcattacgagaaatgcgt
attcgtggtgttaaaactaatattccattcttaattaatgtaatgaagaataaaaagttc
acaagtggtgattacacaactaaatttattgaagaaacaccagaacttttcgacattcag
ccgtctctagatagaggtactaaaacattagaatatataggtaatgtaacaattaatggt
ttcccaaatgttgagaaacgtccgaaaccagactatgaattagcatcaattccaactgta
tcttcaagtaaaatcgcttcatttagtggtacgaaacaattgcttgatgaagtaggtcca
aaaggtgtagctgaatgggttaaaaagcaggatgatgtcttactaacagatacaaccttt
agagatgcacaccaatcattattagctacacgagttagaactaaggatatgattaatatc
gcatccaaaacagcggacgtatttaaagatggtttctcactagaaatgtggggcggtgct
acatttgatgtggcatataatttcttgaaggaaaacccatgggaacgacttgaacgtcta
cgtaaagctattccaaatgtattattccaaatgttgttacgtgcttcaaacgcagttggt
tataaaaactatcctgataatgttattcataaattcgtacaagaaagtgctaaagcaggc
atagatgtctttagaattttcgattcattaaactgggtagatcaaatgaaagttgccaat
gaagcagtacaagaagcgggcaaaatctcagaaggtactatttgttatacaggtgacatt
ttaaatcctgagcgatcaaacatttatactttagagtattatgtcaaactagctaaagag
ttagaacgtgaaggtttccatattttagcgattaaagatatggcaggcttattaaaacct
aaagccgcttacgaattgattggtgagttaaaatcagctgtagatttaccaattcatctt
cacactcatgatacaagtggtaatggtttattaacatacaaacaagcaatagatgctggt
gtcgatatcattgatactgctgttgcttcaatgagtggtttaacaagtcagccaagcgcc
aattcgttatattatgcattaaatggcttcccacgccaccttagaactgatattgaaggt
atggagtcacttagtcattattggtcaactgtacgtacttattattcagactttgaaagt
gatatcaaatcaccgaatactgaaatttatcaacatgaaatgcctggtggacagtattcg
aatttaagtcaacaagctaaaagtttaggtttaggcgaaagatttgatgaagtcaaagat
atgtatcgcagagtgaatttcttatttggtgatatcgtaaaagtaacaccatcgtctaaa
gtagttggtgatatggcactttatatggtacaaaatgatcttgatgaacaatccgtgatt
acagatggctataaattagatttcccagaatcagtagtgtcgttcttcaaaggtgaaata
ggacaacctgtaaatggttttaataaagatttacaagcggttattttaaaaggccaagaa
gcactaacagctcgtccaggtgaatatctagagccagttgattttgaaaaagtccgtgag
ttgcttgaagaagagcaacaaggtcctgttacggagcaagatattattagttatgtacta
tatccaaaagtatatgaacaatatattcaaactagaaatcaatacggaaacttatcgtta
cttgatacgcctacattcttctttggaatgcgtaatggtgaaacagtagaaatcgaaatc
gataaaggtaaacgattaattattaaactagaaacgattagtgaaccagatgaaaatggt
aatagaacgatttactatgcgatgaatggtcaagcgagacgtatttacattaaagatgaa
aatgtgcatacaaatgcgaacgttaagccaaaagcagataagagtaatccaagtcatatc
ggtgctcaaatgccaggttcagtaactgaagtcaaggttagtgtaggtgaaactgtgaaa
gctaatcagccgttgctaattactgaagctatgaaaatggaaacaacaattcaagcacca
tttgacggtgtgattaaacaagtaactgtaaataatggtgacacaatagcgacaggcgat
ttattaatcgaaattgaaaaagcaactgactaa

DBGET integrated database retrieval system