KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL1406Help
Entry
SACOL1406         CDS       T00225                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sac01100  Metabolic pathways
sac01110  Biosynthesis of secondary metabolites
sac01130  Biosynthesis of antibiotics
sac01230  Biosynthesis of amino acids
Module
sac_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sac00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SACOL1406 (trpC)
Enzymes [BR:sac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SACOL1406 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh His_biosynth
Motif
Other DBs
NCBI-ProteinID: AAW36654
UniProt: Q9RL78
Position
1417185..1417967
Genome map
AA seq 260 aa AA seqDB search
MTILSEIVKYKQSLLQNGYYQDKLNTLKSVKIQNKKSFINAIEKEPKLAIIAEIKSKSPT
VNDLPERDLSQQISDYDQYGANAVSILTDEKYFSGSFERLQALTTKTTLPVLCKDFIIDP
LQIDVAKQAGASMILLIVNILSDKQLKDLYNYAISQNLEVLVEVHDRHELERAYKVNAKL
IGVNNRDLKRFVTNVEHTNTILENKKTNHYYISESGIHDASDVRKILHSGIDGLLIGEAL
MRCDNLSEFLPQLKMQKVKS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacgattttatcagaaattgttaaatataaacagtcacttttacaaaatggctattat
caagacaaacttaataccttgaaaagtgtgaagattcagaataaaaaatcttttataaac
gcaattgagaaagaaccaaagctagcaattattgcagaaattaaatcgaagagtcctaca
gttaatgacttacctgaacgagatttatcgcaacaaatctcagattatgaccaatatggt
gcaaatgccgtgtccattttaactgatgaaaagtactttagtggtagttttgaaagatta
caagcattgacgacaaaaacaacattacccgtattatgcaaagactttattatagacccg
cttcaaattgatgttgctaaacaagctggtgcatctatgattttattgatcgttaacatc
ttatctgataaacaattgaaagatttatataactacgctatatcgcaaaatctagaagtg
ttagttgaagtacatgatcgccatgaattagaacgtgcctataaggttaatgctaaattg
attggtgtaaataacagggacttaaaacgatttgttacaaatgtggaacatacaaatact
attttagaaaataaaaaaacaaatcattattatatttctgaaagtggtattcacgatgca
tctgatgtaagaaaaatcttgcatagtggtatcgatggcttactaataggtgaggcgctt
atgcgttgtgacaatctatctgaatttttaccacaactgaaaatgcaaaaggtgaagtca
tga

DBGET integrated database retrieval system