KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL1546
Entry
SACOL1546         CDS       T00225                                 

Gene name
proC
Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00330  Arginine and proline metabolism
sac01100  Metabolic pathways
sac01110  Biosynthesis of secondary metabolites
sac01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SACOL1546 (proC)
Enzymes [BR:sac01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     SACOL1546 (proC)
SSDB
Motif
Pfam: P5CR_dimer F420_oxidored PDH GFO_IDH_MocA DUF4918 NAD_Gly3P_dh_N ApbA
Other DBs
NCBI-ProteinID: AAW36739
UniProt: Q5HFR9
Position
1582014..1582829
AA seq 271 aa
MKLVFYGAGNMAQAIFTGIINSSNLDANDIYLTNKSNEQALKAFAEKLGVNYSYDDATLL
KDADYVFLGTKPHDFDALATRIKPHITKDNCFISIMAGIPIDYIKQQLECQNPVARIMPN
TNAQVGHSVTGISFSNNFDPKSKDEINDLVKAFGSVIEVSEDHLHQVTAITGSGPAFLYH
VFEQYVKAGTKLGLEKEQVEESIRNLIIGTSKMIERSDLSMAQLRKNITSKGGTTQAGLD
TLSQYDLVSIFEDCLNAAVDRSIELSNIEDQ
NT seq 816 nt   +upstreamnt  +downstreamnt
atgaaactcgtattttatggagctggtaatatggcacaagctatatttacaggaattatt
aactcaagcaacttagatgccaatgatatatatttaacaaataaatctaatgaacaagct
ttaaaagcattcgctgaaaaactaggtgttaactatagttatgatgatgcgacattatta
aaagatgcagattatgtatttttaggtaccaaaccacatgattttgatgctctagcaaca
cgcatcaaaccacatattacaaaagacaattgcttcatttcaattatggcaggtattccg
attgattatattaaacaacaattagaatgccaaaatccagttgctagaattatgccaaac
acaaatgcgcaagttggacactctgttactggcattagtttttcaaacaactttgaccct
aaatctaaagatgaaattaacgatttagttaaagcatttggttctgtaattgaagtatca
gaagatcatttacatcaagtaacagctatcaccggaagcggcccagcatttttatatcat
gtattcgagcaatatgttaaagctggtacgaaacttggtctagaaaaagaacaagttgaa
gaatctatacgcaaccttattataggtacaagtaagatgattgaacgttcagatttgagc
atggctcaattaagaaaaaatattacctctaaaggtggtacgacacaagctggccttgat
acattgtcacaatatgatttagtatctattttcgaagattgtctaaacgctgccgtcgac
cgtagtattgaactttctaatatagaagaccaataa

DBGET integrated database retrieval system