KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL1595Help
Entry
SACOL1595         CDS       T00225                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00260  Glycine, serine and threonine metabolism
sac00630  Glyoxylate and dicarboxylate metabolism
sac00670  One carbon pool by folate
sac01100  Metabolic pathways
sac01110  Biosynthesis of secondary metabolites
sac01130  Biosynthesis of antibiotics
sac01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SACOL1595 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SACOL1595 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SACOL1595 (gcvT)
Enzymes [BR:sac01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     SACOL1595 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: AAW38211
UniProt: Q5HFM2
Position
complement(1628778..1629869)
Genome map
AA seq 363 aa AA seqDB search
MSSDLKQTPLYQNYVDRGAKIVEFGGWAMPVQFSSIKEEHNAVRYEIGLFDVSHMGEIEV
TGKDASQFVQYLLSNDTDNLTTSKALYTALCNEEGGIIDDLVIYKLADDNYLLVVNAANT
EKDFNWILKHKEKFDVEVQNVSNQYGQLAIQGPKARDLINQLVDEDVTEMKMFEFKQGVK
LFGANVILSQSGYTGEDGFEIYCNIDDTEKIWDGLLEYNVMPCGLGARDTLRLEAGLPLH
GQDLTESITPYEGGIAFASKPLIDADFIGKSVLKDQKENGAPRRTVGLELLEKGIARTGY
EVMDLDGNIIGEVTSGTQSPSSGKSIALAMIKRDEFEMGRELLVQVRKRQLKAKIVKKNQ
IDK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtgatttaaaacaaacacctttatatcaaaattatgttgatagaggtgcaaaa
attgtggaattcggaggatgggcgatgcctgttcaattttcaagtattaaagaggagcat
aatgctgttcgatacgaaattggcctgtttgatgttagtcatatgggtgaaattgaagta
acaggtaaagatgctagtcagtttgtgcaatatttattatcaaatgatactgataattta
actacttcaaaagcattatatactgctttatgtaatgaagaaggcggtattattgatgat
ttagtaatatataaattagctgacgacaattatttattagttgttaatgctgctaatact
gaaaaagattttaattggattttaaaacacaaagagaaatttgatgttgaagtacaaaat
gtatcaaaccaatatggtcaattagcaatacaaggaccaaaagctagagatttaattaat
caattagttgatgaagatgtaactgaaatgaaaatgtttgaatttaaacagggtgtcaaa
ttatttggagcaaacgtcattttatctcagtcaggttacacaggtgaagatgggtttgaa
atttattgtaatatcgatgatactgaaaaaatttgggatggtttattagagtataatgtt
atgccatgtgggttaggcgctcgtgatacattaagattagaggctggattgccattacat
ggacaagatttaactgaatcaattacaccatatgaaggtggtatcgcttttgcaagtaaa
ccattaattgatgctgattttattggtaaatctgtattaaaagatcaaaaagaaaatggt
gcaccaagaagaacagtgggattagaattacttgaaaaaggaattgcaagaactggttat
gaagttatggatttagatggaaatattattggagaagtaacttcaggaacacagtctcca
tcatcaggaaaatcaattgcacttgcaatgataaaaagagatgagtttgaaatgggtaga
gagttgcttgttcaagttcgtaagcgtcaattaaaagcgaaaattgttaagaaaaatcaa
attgataaataa

DBGET integrated database retrieval system