KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL1652Help
Entry
SACOL1652         CDS       T00225                                 

Gene name
aroE
Definition
(GenBank) shikimate 5-dehydrogenase
  KO
K00014  shikimate dehydrogenase [EC:1.1.1.25]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sac01100  Metabolic pathways
sac01110  Biosynthesis of secondary metabolites
sac01130  Biosynthesis of antibiotics
sac01230  Biosynthesis of amino acids
Module
sac_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sac00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SACOL1652 (aroE)
Enzymes [BR:sac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.25  shikimate dehydrogenase
     SACOL1652 (aroE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Shikimate_dh_N Shikimate_DH Sacchrp_dh_NADP ApbA
Motif
Other DBs
NCBI-ProteinID: AAW38268
UniProt: Q5HFG5
Position
complement(1681391..1682197)
Genome map
AA seq 268 aa AA seqDB search
MKFAVIGNPISHSLSPVMHRANFNSLGLDDTYEALNIPIEDFHLIKEIISKKELEGFNIT
IPHKERIIPYLDYVDEQAINAGAVNTVLIKDGKWIGYNTDGIGYVKGLHSVYPDLENAYI
LILGAGGASKGIAYELAKFVKPKLTVANRTMARFESWNLNINQISLADAEKYLAEFDIVI
NTTPAGMAGNNESIINLKHLSPNTLMSDIVYIPYKTPILEEAERKGNHIYNGLDMFVYQG
AESFKIWTNKDADINSMKTAVLQQLKGE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgcagttataggaaatcctatttcacattccttgtcgcccgttatgcataga
gcaaattttaattctttaggattagatgatacttatgaagctttaaatattccaattgaa
gattttcatttaattaaagaaattatttcgaaaaaagaattagaaggctttaatatcaca
attcctcataaagaacgtatcataccgtatttagattatgttgatgaacaagcgattaat
gcaggtgcagttaacactgttttgataaaagatggcaagtggatagggtataatacagat
ggtattggttatgttaaaggattgcacagcgtttatccagatttagaaaatgcatacatt
ttaattttgggcgcaggtggtgcaagtaaaggtattgcttatgaattagcaaaatttgta
aagcccaaattaactgttgcgaatagaacgatggctcgttttgaatcttggaatttaaat
ataaaccaaatttcattagcagatgctgaaaagtatttagctgaattcgatatcgttatt
aatacaacaccagcgggtatggctggaaataacgaaagtattattaatttaaagcatctt
tctcccaatactttaatgagtgatattgtttatataccgtataaaacacctattttagag
gaagcagagcgcaagggaaaccatatttataatggcttagatatgtttgtttaccagggt
gcggaaagctttaaaatttggactaataaagatgctgatattaattctatgaaaacagca
gttttacaacaattaaaaggagaataa

DBGET integrated database retrieval system