KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL1719Help
Entry
SACOL1719         CDS       T00225                                 

Gene name
hemA
Definition
(GenBank) glutamyl-tRNA reductase
  KO
K02492  glutamyl-tRNA reductase [EC:1.2.1.70]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00860  Porphyrin and chlorophyll metabolism
sac01100  Metabolic pathways
sac01110  Biosynthesis of secondary metabolites
sac01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SACOL1719 (hemA)
Enzymes [BR:sac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.70  glutamyl-tRNA reductase
     SACOL1719 (hemA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Shikimate_DH GlutR_N GlutR_dimer OCD_Mu_crystall F420_oxidored NAD_binding_7 THF_DHG_CYH_C AlaDh_PNT_C IlvN ThiF
Motif
Other DBs
NCBI-ProteinID: AAW36824
UniProt: Q5HFA0
Position
complement(1749527..1750873)
Genome map
AA seq 448 aa AA seqDB search
MHFIAISINHRTADVALREQVAFRDDALRIAHEDLYETKSILENVILSTCNRTEVYAVVD
QIHTGRYYIQRFLARAFGFEVDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQ
IRDAFFLAQSTGTTGTIFNHLFKQAITFAKRAHNETDIADNAVSVSYAAVELAKKVFGKL
KSKQAIIIGAGEMSELSLLNLLGSGITDITVVNRTIENAMKLAAKHQVKYDELSSLPNLL
ESADIVISSTSAQSYIITNEMIERIAENRKQDSLVLIDIAVPRDIEPGISAITNIFNYDV
DDLKGLVDANLRERQLAAATISEQIPAEIHAHNEWISMLGVVPVIRALREKAMAIQAETM
DSIDRKLPGLSERERKIISKHTKSIINQMLKDPIKQAKELSSDKKSNEKLELFQNIFDIE
AECPHEQAKQQKESKVKEISARRIFSFE
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgcattttattgcaattagtataaatcatcgcacagctgatgttgcactaagagagcaa
gttgcttttagagatgatgccttacgaattgcccatgaagatttatatgaaactaaatct
attttagaaaatgtcatattatcaacatgtaatcgaactgaagtatatgctgttgttgat
caaattcacacaggtcgttactatattcaacgatttctagctcgtgcatttggatttgaa
gtagatgatattaaagcaatgtcagaagtaaaagtgggggacgaagcagtagaacattta
ttgcgtgtcacttctggtttagattcaatcgtacttggagaaactcaaattttaggtcaa
ataagagatgcatttttcttagcgcaaagcacaggtacgacaggaacaatttttaatcat
ctatttaaacaggcaattacttttgcaaaaagagcacataatgaaacagatatagctgat
aatgctgtaagtgtgtcttatgctgcggtcgagttggcgaaaaaagtatttggcaaattg
aaaagtaagcaagctatcattattggtgcaggggaaatgagtgaattatcactattaaat
cttcttggttctggaattactgatattacagtagtaaatagaacaattgaaaatgctatg
aaattagcagcaaagcatcaagtgaaatatgatgaactatcatcattaccaaatttactt
gaaagtgcagatattgtgattagttcaacgagtgcacaatcttatatcattacaaatgaa
atgatagaaagaattgcagaaaatagaaagcaagattcactagtattgattgatattgca
gttcctcgagatattgaacctggtattagtgccatcacaaacatctttaattatgatgtt
gatgacttaaaaggtttagttgatgcaaacttacgtgagcgacaattagcggctgcaaca
atttcggaacaaattcctgcagaaatacatgcacacaatgagtggattagtatgttgggt
gttgttccagtgattagagctttacgtgaaaaagctatggcaattcaagcagaaacgatg
gacagtattgatcgtaaattgccagggttaagcgaaagagaacgtaaaattatatctaaa
catacaaaaagtatcatcaatcaaatgttgaaagatcctattaaacaggccaaagaatta
agtagtgataagaaaagtaatgaaaaattagagctatttcaaaatatatttgatatcgaa
gctgaatgtcctcatgagcaagcgaagcaacaaaaagaaagcaaggtcaaggaaatttca
gcgcgacgtatctttagttttgaataa

DBGET integrated database retrieval system