KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL1762Help
Entry
SACOL1762         CDS       T00225                                 

Definition
(GenBank) thiol peroxidase, putative
  KO
K11065  thiol peroxidase, atypical 2-Cys peroxiredoxin [EC:1.11.1.15]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Brite
KEGG Orthology (KO) [BR:sac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SACOL1762
Enzymes [BR:sac01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     SACOL1762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AAW38291
UniProt: Q5HF61
Structure
PDB: 

Position
complement(1801857..1802351)
Genome map
AA seq 164 aa AA seqDB search
MTEITFKGGPIHLKGQQINEGDFAPDFTVLDNDLNQVTLADYAGKKKLISVVPSIDTGVC
DQQTRKFNSDASKEEGIVLTISADLPFAQKRWCASAGLDNVITLSDHRDLSFGENYGVVM
EELRLLARAVFVLDADNKVVYKEIVSEGTDFPDFDAALAAYKNI
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaataacattcaaaggtggaccaatccacttaaaaggtcaacaaattaatgaa
ggtgattttgcacctgattttacagtgttagataatgacttaaatcaagtaacattagca
gattatgctggtaaaaagaaattaattagtgtggtaccatcaattgatacaggtgtttgt
gatcagcagactcgcaaattcaactctgatgcttctaaagaagaggggattgtgcttaca
atttcagcagacttaccattcgcacaaaaaagatggtgcgcttcagcaggtttagacaat
gtcattacattaagtgaccaccgtgacttatcatttggtgaaaactatggcgttgttatg
gaagaacttcgcttattagctcgtgcagtatttgtattagatgcagataataaagttgtt
tataaagaaatcgttagtgaaggtactgatttcccagattttgatgctgctttagctgca
tacaaaaatatttaa

DBGET integrated database retrieval system