KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2060Help
Entry
SACOL2060         CDS       T00225                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00473  D-Alanine metabolism
sac01100  Metabolic pathways
sac01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SACOL2060 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    SACOL2060 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sac01011]
    SACOL2060 (alr)
Enzymes [BR:sac01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SACOL2060 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:sac01011]
 Precursor biosynthesis
  Racemase
   SACOL2060 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AAW37022
UniProt: Q5HED1
Structure
PDB: 

Position
complement(2124829..2125977)
Genome map
AA seq 382 aa AA seqDB search
MSDKYYRSAYMNVDLNAVASNFKVFSTLHPNKTVMAVVKANAYGLGSVKVARHLMENGAT
FFAVATLDEAIELRMHGITAKILVLGVLPAKDIDKAIQHRVALTVPSKQWLKEAIKNISG
EQEKKLWLHIKLDTGMGRLGIKDTKTYQEVIEIIQQYEQLVFEGVFTHFACADEPGDMTT
EQYQRFKDMVNEAIKPEYIHCQNSAGSLLMDCQFCNAIRPGISLYGYYPSEYVQQKVKVH
LKPSVQLIANVVQTKTLQAGESVSYGATYTATDPTTIALLPIGYADGYLRIMQGSFVNVN
GHQCEVIGRVCMDQTIVKVPDQVKAGDSVILIDNHRESPQSVEVVAEKQHTINYEVLCNL
SRRLPRIYHDGDQRFVTNELLK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtcggataaatattatagatctgcgtatatgaatgtagatttaaacgctgttgcatca
aatttcaaagtattcagtacattgcatccaaataaaacagtgatggctgtcgttaaagcc
aatgcctatggactaggtagtgttaaagtagcacgtcatttaatggaaaatggcgccaca
ttttttgctgtagcaacgttagatgaagcgatagaacttagaatgcatgggattactgct
aaaattttagtcttaggtgtgttaccagctaaagatattgataaagcgatacaacaccga
gttgccttaacggttccgtctaaacagtggttgaaagaagcaattaaaaacatttctggt
gagcaagagaaaaagttatggttgcacattaaattagatacaggaatgggacgtttaggt
attaaagatactaaaacgtatcaagaagtgattgaaatcattcaacaatatgagcaactt
gtatttgaaggcgtgtttacacactttgcctgtgctgacgaaccaggagatatgacaact
gaacaatatcaacgttttaaagatatggtcaatgaagcaattaaacctgaatatatacat
tgtcagaactcagcaggctctctattaatggattgccaattctgtaatgcaataagacca
ggaatttccctttatggatattatccatcagagtatgtacagcaaaaagttaaagtacac
cttaaaccaagtgtgcaattaattgctaatgtagttcaaacaaagacgctacaagcgggt
gagtctgtaagttatggtgcaacttatacagctactgacccaactacaatagcattgtta
cctattggatatgcagatggctatttacgcataatgcaaggtagctttgtaaatgtaaat
ggtcatcaatgcgaagttattggtcgcgtatgtatggatcagacaattgttaaagtgcca
gatcaagttaaagctggagattcggtgattttaatagataatcatagagaaagtccacag
tcggtagaggtggtagctgaaaagcaacatactattaattatgaagtgctttgtaacttg
tcgagacgtttgccgcgaatctatcatgatggtgatcaacgttttgtaacaaatgaattg
ttaaaataa

DBGET integrated database retrieval system