KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2511
Entry
SACOL2511         CDS       T00225                                 

Gene name
fnbA
Definition
(GenBank) fibronectin-binding protein A
  KO
K13732  fibronectin-binding protein A
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:sac00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    SACOL2511 (fnbA)
SSDB
Motif
Pfam: SdrG_C_C Fn_bind Big_8 Gram_pos_anchor YSIRK_signal
Other DBs
NCBI-ProteinID: AAW37290
UniProt: Q5HD51
Structure
PDB: 
4B60 2RKZ 4B5Z

Position
complement(2569440..2572496)
AA seq 1018 aa
MKNNLRYGIRKHKLGAASVFLGTMIVVGMGQDKEAAASEQKTTTVEENGNSATDNKTSET
QTTATNVNHIEETQSYNATVTEQPSNATQVTTEEAPKAVQAPQTAQPANIETVKEEVVKE
EAKPQVKETTQSQDNSGDQRQVDLTPKKATQNQVAETQVEVAQPRTASESKPRVTRSADV
AEAKEASNAKVETGTDVTSKVTVEIGSIEGHNNTNKVEPHAGQRAVLKYKLKFENGLHQG
DYFDFTLSNNVNTHGVSTARKVPEIKNGSVVMATGEVLEGGKIRYTFTNDIEDKVDVTAE
LEINLFIDPKTVQTNGNQTITSTLNEEQTSKELDVKYKDGIGNYYANLNGSIETFNKANN
RFSHVAFIKPNNGKTTSVTVTGTLMKGSNQNGNQPKVRIFEYLGNNEDIAKSVYANTTDT
SKFKEVTSNMSGNLNLQNNGSYSLNIENLDKTYVVHYDGEYLNGTDEVDFRTQMVGHPEQ
LYKYYYDRGYTLTWDNGLVLYSNKANGNGKNGPIIQNNKFEYKEDTIKETLTGQYDKNLV
TTVEEEYDSSTLDIDYHTAIDGGGGYVDGYIETIEETDSSAIDIDYHTAVDSEAGHVGGY
TESSEESNPIDFEESTHENSKHHADVVEYEEDTNPGGGQVTTESNLVEFDEESTKGIVTG
AVSDHTTVEDTKEYTTESNLIELVDELPEEHGQAQGPVEEITENNHHISHSGLGTENGHG
NYDVIEEIEENSHVDIKSELGYEGGQNSGNQSFEEDTEEDKPKYEQGGNIVDIDFDSVPQ
IHGQNKGNQSFEEDTEKDKPKYEHGGNIIDIDFDSVPHIHGFNKHTEIIEEDTNKDKPSY
QFGGHNSVDFEEDTLPKVSGQNEGQQTIEEDTTPPIVPPTPPTPEVPSEPETPTPPTPEV
PSEPETPTPPTPEVPSEPETPTPPTPEVPAEPGKPVPPAKEEPKKPSKPVEQGKVVTPVI
EINEKVKAVAPTKKPQSKKSELPETGGEESTNKGMLFGGLFSILGLALLRRNKKNHKA
NT seq 3057 nt   +upstreamnt  +downstreamnt
gtgaaaaacaatcttaggtacggcattagaaaacataaattgggagcagcatcagtattc
ttaggaacaatgatcgttgttgggatgggacaagacaaagaagctgcagcatcagaacaa
aagacaactacagtagaagaaaatgggaattcagctactgataataaaacaagtgaaaca
caaacaactgcaactaacgttaatcatatagaagaaactcaatcatataacgcaacagta
acagaacaaccgtcaaacgcaacacaagtaacaactgaagaagcaccaaaagcagtacaa
gcaccacaaactgcacaaccagcaaatatagaaacagttaaagaagaggtagttaaggaa
gaagcgaaacctcaagttaaggaaacaacacaatctcaagacaatagcggagatcaaaga
caagtagatttaacacctaaaaaggctacacaaaatcaagtcgcagaaacacaagttgaa
gtggcacagccaagaacggcatcagaaagtaagccacgtgtgacaagatcagcagatgta
gcggaagctaaggaagctagtaacgcgaaagtggaaacgggtacagatgtaacaagtaaa
gttacagtagaaattggttctattgaggggcataacaatacaaataaagtagaacctcat
gcaggacaacgagcggtactaaaatataagttgaaatttgagaatggtttacatcaaggt
gactactttgactttactttatcaaataatgtaaatacgcatggcgtatcaactgctaga
aaagtaccagaaattaaaaatggttcagtcgtaatggcgacaggtgaagttttagaaggt
ggaaagattagatatacatttacaaatgatattgaagataaggttgatgtaacggctgaa
ctagaaattaatttatttattgatcctaaaactgtacaaactaatggaaatcaaactata
acttcaacactaaatgaagaacaaacttcaaaggaattagatgttaaatataaagatggt
attgggaattattatgccaatttaaatggatcgattgagacatttaataaagcgaataat
agattttcgcatgttgcatttattaaacctaataatggtaaaacgacaagtgtgactgtt
actggaactttaatgaaaggtagtaatcagaatggaaatcaaccaaaagttaggatattt
gaatacttgggtaataatgaagacatagcgaagagtgtatatgcaaatacgacagatact
tctaaatttaaagaagtcacaagtaatatgagtgggaatttgaatttacaaaataatgga
agctattcattgaatatagaaaatctagataaaacttatgttgttcactatgatggagag
tatttaaatggtactgatgaagttgattttagaacacaaatggtaggacatccagagcaa
ctttataagtattattatgatagaggatataccttaacttgggataatggtttagtttta
tacagtaataaagcgaacggaaatgggaaaaatggtccgattattcaaaataataaattt
gaatataaagaagatacaattaaagaaactcttacaggtcaatatgataagaatttagta
actactgttgaagaggaatatgattcatcaactcttgacattgattaccacacagctata
gatggtggaggtggatatgttgatggatacattgaaacaatagaagaaacggattcatca
gctattgatatcgattaccatactgctgtggatagcgaagcaggtcacgttggaggatac
actgagtcctctgaggaatcaaatccaattgactttgaagaatctacacatgaaaattca
aaacatcacgctgatgttgttgaatatgaagaagatacaaacccaggtggtggtcaggtt
actactgagtctaacttagttgaatttgacgaagagtctacaaaaggtattgtaactggc
gcagtgagcgatcatacaacagttgaagatacgaaagaatatacaactgaaagtaatctg
attgaattagtggatgaattacctgaagagcatggtcaagcacaaggaccagtcgaggaa
attactgaaaacaatcatcatatttctcattctggtttaggaactgaaaatggtcacggg
aattatgacgtgattgaagaaatcgaagaaaatagccacgttgatattaagagtgaatta
ggttatgaaggtggccaaaatagcggtaaccagtcattcgaggaagacacagaagaagac
aaacctaaatatgaacaaggtggcaatatcgtagatatcgattttgatagtgtacctcaa
attcatggtcaaaataaaggtaatcagtcattcgaggaagatacagaaaaagacaaacct
aagtatgaacatggcggtaacatcattgatatcgacttcgacagtgtgccacatattcac
ggattcaataagcacactgaaattattgaagaagatacaaataaagataaaccaagttat
caattcggtggacacaatagtgttgactttgaagaagatacacttccaaaagtaagcggc
caaaatgaaggtcaacaaacgattgaagaagatacaacacctccaatcgtgccaccaacg
ccaccgacaccagaagtaccaagtgagccggaaacaccaacgccaccaacaccagaagta
ccaagtgagccggaaacaccaacaccaccgacaccagaagtgccgagtgagccagaaact
ccaacaccgccaacaccagaggtaccagctgaacctggtaaaccagtaccacctgccaaa
gaagaacctaaaaagccttctaaaccagtggaacaaggtaaagtagtaacacctgttatt
gaaatcaatgaaaaggttaaagcagtggcaccaactaaaaaaccacaatctaagaaatct
gaactacctgaaacaggtggagaagaatcaacaaacaaaggtatgttgttcggcggatta
ttcagcattctaggtttagcattattacgcagaaataaaaagaatcacaaagcataa

DBGET integrated database retrieval system