KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2561Help
Entry
SACOL2561         CDS       T00225                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00072  Synthesis and degradation of ketone bodies
sac00280  Valine, leucine and isoleucine degradation
sac00650  Butanoate metabolism
sac00900  Terpenoid backbone biosynthesis
sac01100  Metabolic pathways
sac01110  Biosynthesis of secondary metabolites
sac01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SACOL2561
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SACOL2561
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SACOL2561
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SACOL2561
Enzymes [BR:sac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     SACOL2561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N Chal_sti_synt_N ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AAW37337
UniProt: A0A0H2WX88
Structure
PDB: 

Position
2619624..2620790
Genome map
AA seq 388 aa AA seqDB search
MTIGIDKINFYVPKYYVDMAKLAEARQVDPNKFLIGIGQTEMAVSPVNQDIVSMGANAAK
DIITDEDKKKIGMVIVATESAVDAAKAAAVQIHNLLGIQPFARCFEMKEACYAATPAIQL
AKDYLATRPNEKVLVIATDTARYGLNSGGEPTQGAGAVAMVIAHNPSILALNEDAVAYTE
DVYDFWRPTGHKYPLVDGALSKDAYIRSFQQSWNEYAKRQGKSLADFASLCFHVPFTKMG
KKALESIIDNADETTQERLRSGYEDAVDYNRYVGNIYTGSLYLSLISLLENRDLQAGETI
GLFSYGSGSVGEFYSATLVEGYKDHLDQAAHKALLNNRTEVSVDAYETFFKRFDDVEFDE
EQDAVHEDRHIFYLSNIENNVREYHRPE
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacaataggtatcgataaaataaacttttacgttccaaagtactatgtagacatggct
aaattagcagaagcacgccaagtagacccaaacaaatttttaattggaattggtcaaact
gaaatggctgttagtcctgtaaaccaagacatcgtttcaatgggcgctaacgctgctaag
gacattataacagacgaagacaaaaagaaaattggtatggtaattgtggcaactgaatca
gcagttgatgctgctaaagcagccgctgttcaaattcacaacttattaggtattcaacct
tttgcacgctgctttgaaatgaaagaagcttgttatgctgcaacaccagcaattcaatta
gctaaagattatttagcaactagaccgaatgaaaaagtattagttattgctacagataca
gcacgttatggattgaattcaggcggcgagccaacacaaggtgctggcgcagttgcgatg
gttattgcacataatccaagcattttggcattaaatgaagatgctgttgcttacactgaa
gacgtttatgatttctggcgtccaactggacataaatatccattagttgatggtgcatta
tctaaagatgcttatatccgctcattccaacaaagctggaatgaatacgcaaaacgtcaa
ggtaagtcgctagctgacttcgcatctctatgcttccatgttccatttacaaaaatgggt
aaaaaggcattagagtcaatcattgataacgctgatgaaacaactcaagagcgtttacgt
tcaggatatgaagatgctgtagattataaccgttatgtcggtaatatttatactggatca
ttatatttaagcctaatatcattacttgaaaatcgagatttacaagctggtgaaacaatc
ggtttattcagttatggctcaggttcagttggtgaattttatagtgcgacattagttgaa
ggctacaaagatcatttagatcaagctgcacataaagcattattaaataaccgtactgaa
gtatctgttgatgcatatgaaacattcttcaaacgttttgatgacgttgaatttgacgaa
gaacaagatgctgttcatgaagatcgtcatattttctacttatcaaatattgaaaataac
gttcgtgaatatcacagaccagagtag

DBGET integrated database retrieval system