KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2595
Entry
SACOL2595         CDS       T00225                                 

Definition
(GenBank) hypothetical protein
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
SSDB
Motif
Pfam: TIM
Other DBs
NCBI-ProteinID: AAW38596
UniProt: A0A0H2WZG7
Position
2656321..2656428
AA seq 35 aa
MLQTLKLEVYKKCFCNRCNKHAIQYGGEVNEKYYV
NT seq 108 nt   +upstreamnt  +downstreamnt
atgttacaaacattgaaattagaggtatataaaaaatgcttctgcaatagatgcaataaa
catgcaatacaatatggaggcgaagtaaatgaaaagtattacgtttga

DBGET integrated database retrieval system