KEGG   Saccharibacillus sp. ATSA2: FFV09_04040Help
Entry
FFV09_04040       CDS       T06082                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
saca  Saccharibacillus sp. ATSA2
Pathway
saca00860  Porphyrin and chlorophyll metabolism
saca01100  Metabolic pathways
saca01110  Biosynthesis of secondary metabolites
saca01120  Microbial metabolism in diverse environments
Module
saca_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:saca00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FFV09_04040 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:saca01007]
    FFV09_04040 (hemL)
Enzymes [BR:saca01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     FFV09_04040 (hemL)
Amino acid related enzymes [BR:saca01007]
 Aminotransferase (transaminase)
  Class III
   FFV09_04040 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: QDH20100
UniProt: A0A4Y6UTN4
Position
complement(1002488..1003789)
Genome map
AA seq 433 aa AA seqDB search
MSESVSKRVDVRSGEAFAEAKKYIPGGVNSPVRAFKSVGLTPVYIERGEGPRVYDIDGNT
FIDYVGSWGPLIMGHAHPDVVRALQETAAKGTSFGAPTLLETEMAKLVAERVPSVDIVRM
VNSGTEATMSAIRLARGVTKRDKILKFEGSYHGHGDSLLIKAGSGVATLGLPDSPGVPES
VASNTITVPYNDLDSLRVAFDKFGEQIACVIVEPVAGNMGVVPPKAGFLEGLREVTERHG
SLLIFDEVMTGFRVGLNSAQGRFGVTPDLTCFGKVIGGGLPVGAYGGKREIMEQIAPSGP
IYQAGTLSGNPLAMAAGYTTLKLLTPAVYDRLEAAGARLQAGFEQNAREAGIPVTINRVG
SMVCPFFNEGPVVDYDTAKSSDLERFRRYFGAMLDRGVSVAPSQFEGMFVSGVHTDADID
QTIEAHRGALRSL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagtccgtatccaaacgcgtcgacgtccgttcgggcgaagcgttcgcggaagcc
aaaaaatatattcccggcggcgtaaacagtcctgtccgggcattcaaatcggtaggtctg
accccggtctacatcgagcgcggcgaaggtccccgcgtctacgacatcgacggcaacacg
tttatcgactatgtcggatcgtggggtccgctcattatgggccacgcgcatcccgacgtc
gtgcgcgccctgcaggagacggcggccaaaggcaccagcttcggcgcgccgacactgctg
gagaccgagatggcgaagctcgtcgccgagcgggtgccgtcggtcgatatcgtccggatg
gtcaactccggcacggaagcgacgatgagtgcgatccggctggcccggggcgtcaccaaa
cgggacaaaattttgaaattcgaaggttcgtaccacggccacggcgacagcctgctgatc
aaagccggttcgggcgtcgcgacgctcggcctgccggacagccccggcgtgccggaatcg
gtcgcttcgaacacgatcacggttccgtacaacgatctggattcgcttcgcgtcgcattc
gacaagttcggcgagcagattgcctgcgtcatcgtcgagccggtcgccggcaatatgggc
gtcgtgcctcccaaggccggcttcctcgaaggactgcgtgaagtgacggagcgccacggc
agcctgctgatcttcgacgaagtcatgaccggcttccgcgtcggcttgaattccgcgcag
ggacgcttcggcgtcacgcccgatctgacctgcttcggcaaggtcatcggcggcggactg
ccggtcggcgcttacggcggcaagcgcgagatcatggagcagatcgcgccgagcggcccg
atctaccaggccggcacgctgagcggcaacccgctggcgatggccgcgggctacacgacg
ctcaagctgctgaccccggccgtgtacgaccggctggaagcggccggcgcgcggctgcag
gcgggcttcgagcagaatgcccgcgaagccggcattccggtgacgatcaaccgcgtcggc
tcgatggtctgcccgttcttcaacgaagggccggtcgtcgattacgatacggccaagtcg
agcgacctggaacggttccgccgttacttcggagcgatgctcgaccgcggcgtcagcgtg
gcgccgtcgcagttcgaaggcatgttcgtctcgggcgtacacaccgacgccgatatcgat
caaacgatcgaagcgcatcgcggcgcgctgaggtcgctataa

DBGET integrated database retrieval system