KEGG   Saccharibacillus sp. ATSA2: FFV09_16970Help
Entry
FFV09_16970       CDS       T06082                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
saca  Saccharibacillus sp. ATSA2
Pathway
saca00480  Glutathione metabolism
saca00590  Arachidonic acid metabolism
saca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    FFV09_16970
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FFV09_16970
Enzymes [BR:saca01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     FFV09_16970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: QDH22383
UniProt: A0A4Y6UXD5
Position
complement(4090411..4090890)
Genome map
AA seq 159 aa AA seqDB search
MSVYEYEARTSKGDEVKLSDYAGKVVLVVNTASKCGFTPQFQGLQDLYDKYHDRGLEILG
FPSNQFKEQDPGTNEEIAEFCQVNYGVKFPIFEKVDVKGENAHPLFQYLSDEAPGLMGSK
SVKWNFTKFLIDKEGRPVKRFAPQTAPDQLEKDIEKLLG
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgtatgaatacgaagcccgcacgtccaagggggacgaagtcaagctgtccgat
tacgcaggaaaagtggtgctcgttgtcaacaccgcgagcaagtgcggatttacgccgcag
ttccagggcttgcaggatctgtacgacaaataccacgaccgcggcctggagattctcggc
ttcccgagcaaccagttcaaggaacaggaccccggcaccaacgaggaaatcgcagagttt
tgccaagtgaactacggcgtcaaattcccgatcttcgaaaaagtggacgtcaaaggcgaa
aacgcgcatcccctgttccaatatttgagcgacgaagcgccgggccttatgggttccaaa
tcggtcaaatggaacttcaccaaattcctgatcgacaaagaaggccgcccggtcaagcgc
ttcgctccgcaaacggcaccggatcagctggagaaagacatcgaaaaactgctcggctga

DBGET integrated database retrieval system