KEGG   Saccharomonospora sp. 31sw: EYD13_00740Help
Entry
EYD13_00740       CDS       T05928                                 

Gene name
lhgO
Definition
(GenBank) L-2-hydroxyglutarate oxidase LhgO
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
sacc  Saccharomonospora sp. 31sw
Pathway
sacc00310  Lysine degradation
sacc01100  Metabolic pathways
sacc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sacc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    EYD13_00740 (lhgO)
Enzymes [BR:sacc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     EYD13_00740 (lhgO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox NAD_binding_8 Pyr_redox_2 FAD_binding_3 HI0933_like Amino_oxidase FAD_binding_2 NAD_binding_7 Pyr_redox_3 TrkA_N 3HCDH_N ApbA AlaDh_PNT_C adh_short 2-Hacid_dh_C XdhC_C GIDA
Motif
Other DBs
NCBI-ProteinID: QBQ58538
UniProt: A0A4P7C2N5
Position
complement(155422..156612)
Genome map
AA seq 396 aa AA seqDB search
MRHVTVIGGGIIGLAVARELTARGCHVTVLEKENRWAAHQSGHNSGVVHAGLYYRPGSLK
ARLSVAGNRSMIAFAREHGVPYDVCGKLVVATSVAELPALGLLAERARACGVGATLLDAA
HAREYEPEVSCVRALRVHSTAVIDFPTVCRVLASLLREAGADLRLGTPALAVRAGRNGGV
EVATPHDVVKADTLVNCAGLHSDRVARLAGLTPATRIVPFRGEYHELRPGRRHLVRGLIY
PVPDPALPFLGVHLTRLLDGSVHAGPNAVLASRREGYRGRDVSVRDLAEVLAFPGTWRLA
RRHAFPAGWNEVIRSLSKRRFAASLARLVPAIRREDIVRHGSGVRAQALLPDGRLADDFV
IEEARDQVHVLNAPSPAATSALEIAAYVADRVAATG
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtcacgtgaccgtcatcggtggcgggatcatcggtctcgccgtcgcgagggaactc
accgcgcgcggctgccacgtcaccgtgctggagaaggagaaccgctgggccgcgcaccag
tccggccacaactcgggcgtcgtccacgcggggctgtactaccggccgggttcgctgaaa
gcgcggctctcggtggccggcaaccgctcgatgatcgccttcgcgcgcgagcacggcgtg
ccctacgacgtgtgcggcaagctggtggtggccacctccgtcgccgaattgcccgccctc
ggcctgctcgccgagcgggcgcgagcctgcggggtcggcgccaccctgctcgacgccgcg
cacgccagggagtacgagcccgaggtgtcgtgcgtgcgcgcgctgcgggtgcactccacc
gctgtgatcgacttccctaccgtgtgccgagttctggcgtcgctgctgcgtgaagccggg
gccgacctgcggctgggcacgcccgcgctcgccgtgcgtgcggggaggaacggcggtgtc
gaggtggccacaccgcacgacgtcgtgaaggcggacaccctcgtcaactgtgcggggctg
cattccgaccgcgtggccaggctcgcggggctcacaccggcaacccggatcgtgcccttc
aggggcgagtaccacgaactgcggccggggcggcgccatctcgtgcgtggtctgatctac
ccggttcccgacccggcactgccgttcttgggtgtccacctcacgcgcctgctcgacggc
agtgtccacgcgggacccaacgccgtgctcgcgtcgcggcgggagggttaccgcggaagg
gacgtctccgtgcgcgacctcgccgaggtgctggcctttcccggcacgtggcggctcgcg
cggcgccacgccttccccgcgggctggaacgaggtgatccggtcgctgtcgaaacgccgc
ttcgccgcgagtctcgcccgcctcgttccggccatccggagggaggacatcgtgcgccac
ggctccggcgtgcgcgcgcaggccctgctgccggacggaaggctcgccgacgacttcgtc
atcgaagaggcccgcgaccaggtccacgtgctcaacgcgccgtcacccgctgcgacgagc
gcactggagatcgccgcgtacgtcgccgaccgcgtcgccgcgaccggctga

DBGET integrated database retrieval system