KEGG   Saccharomonospora sp. 31sw: EYD13_11875Help
Entry
EYD13_11875       CDS       T05928                                 

Gene name
kamA
Definition
(GenBank) L-lysine 2,3-aminomutase
  KO
K01843  lysine 2,3-aminomutase [EC:5.4.3.2]
Organism
sacc  Saccharomonospora sp. 31sw
Pathway
sacc00310  Lysine degradation
sacc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sacc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    EYD13_11875 (kamA)
Enzymes [BR:sacc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.2  lysine 2,3-aminomutase
     EYD13_11875 (kamA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM
Motif
Other DBs
NCBI-ProteinID: QBQ60728
UniProt: A0A4P7C865
Position
2559498..2560877
Genome map
AA seq 459 aa AA seqDB search
MTATQEPATELAEQPYTYRRVELVEPDWRRFPGWRDVTEAEWRDAQWQRVHCVRNVKQLR
AVMGDLLEDRFYDDLVADQQQMATMSMLLPPQMLNTMAPHAGTDPGKITDAFYTDPIRRY
MMPVRSDRDPDWPSHPHAQRDSLHEAEMWVVEGLTHRYPTKVLAELLSTCPQYCGHCTRM
DLVGNSTPQIDKHKLSLKPVDRQDAMIDYLKRTPGVRDVVVSGGDVANVPWHQLEAFLMR
LLDIETVRDIRLATKALAGLPQHWLQPKVVEGLARVAGTARRRGVNLAIHTHVNHAQSVT
PLVAEAARAALEVGVRDVRNQGVLMRGVNDTPADLLDLCFALQGEANILPYYFYMCDMIP
NSEHWRLAVWEAQELQHAIMGYLPGYATPRIICDVPYVGKRWVHQIAEYDRERGVSYWTK
NYRTGIELDDPEALRRRYPYYDPVSTLPESGQQWWRENS
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgactgccacccaggaacctgctaccgaactcgcggaacagccctacacgtatcggcgc
gtcgagttggtcgaacccgactggcgacgcttcccgggctggcgcgacgtcacggaggcc
gagtggcgcgatgcgcagtggcagcgcgtccactgtgtgcgcaacgtcaagcagctccgc
gccgtcatgggcgatctgctggaggatcggttctacgacgacctcgtcgccgaccagcag
cagatggcaacgatgtcgatgttgttgccgccgcagatgctcaacaccatggcaccccac
gcgggcaccgaccccggcaagatcaccgacgccttctacaccgacccgatccggcgctac
atgatgcccgtgcgcagtgatcgcgacccggactggccgagccatccacacgcccagcgc
gactcgctgcacgaggcggagatgtgggtcgtcgaggggctgacccaccgctaccccacc
aaggtgctcgccgagttactgtccacgtgcccccagtactgcgggcactgcacgcgcatg
gacctcgtcggcaactcgacgccccagatcgacaagcacaagctctcgctcaagccggtg
gaccggcaggacgcgatgatcgactacttgaagcgcacgccgggtgtgcgtgacgtggtg
gtctccggcggtgacgtggccaacgtgccgtggcaccagctggaggcgttcctcatgcga
ctgctcgacatcgagaccgttcgcgacatcaggctggccaccaaggcactcgccgggctg
ccgcagcactggctccagcccaaggtcgtggagggcctcgcccgcgtggctggcaccgcg
cgccgtcgcggggtgaacctcgcgatccacacccacgtcaaccacgcgcagtcggtgacc
ccgctcgtcgcggaggctgcccgcgcggccctggaagtgggggttcgcgacgtacgcaac
cagggcgtgttgatgcggggcgtcaacgacacaccggccgacctgctcgacctgtgcttc
gcgttgcagggcgaggcgaacatcctgccgtactacttctacatgtgcgacatgatcccc
aactccgagcactggcggctcgcggtctgggaggcacaggagctccagcacgccatcatg
ggttacctgcccggctacgcgacgccgcggatcatctgcgacgtgccgtacgtgggcaag
cggtgggtgcaccagatcgcggagtacgaccgcgagcgcggtgtctcgtactggacgaag
aactaccgcaccggcatcgaactcgacgaccccgaggcgctgcgccgccgctacccctac
tacgacccggtgtccacgctgccggagtcagggcagcagtggtggagggagaacagctga

DBGET integrated database retrieval system