KEGG   Saccharomonospora sp. 31sw: EYD13_12610Help
Entry
EYD13_12610       CDS       T05928                                 

Gene name
echA3
Definition
(GenBank) putative enoyl-CoA hydratase echA8
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sacc  Saccharomonospora sp. 31sw
Pathway
sacc00071  Fatty acid degradation
sacc00280  Valine, leucine and isoleucine degradation
sacc00281  Geraniol degradation
sacc00310  Lysine degradation
sacc00360  Phenylalanine metabolism
sacc00362  Benzoate degradation
sacc00380  Tryptophan metabolism
sacc00410  beta-Alanine metabolism
sacc00627  Aminobenzoate degradation
sacc00640  Propanoate metabolism
sacc00650  Butanoate metabolism
sacc00903  Limonene and pinene degradation
sacc00930  Caprolactam degradation
sacc01100  Metabolic pathways
sacc01110  Biosynthesis of secondary metabolites
sacc01120  Microbial metabolism in diverse environments
sacc01130  Biosynthesis of antibiotics
sacc01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sacc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EYD13_12610 (echA3)
   00650 Butanoate metabolism
    EYD13_12610 (echA3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EYD13_12610 (echA3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EYD13_12610 (echA3)
   00310 Lysine degradation
    EYD13_12610 (echA3)
   00360 Phenylalanine metabolism
    EYD13_12610 (echA3)
   00380 Tryptophan metabolism
    EYD13_12610 (echA3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EYD13_12610 (echA3)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EYD13_12610 (echA3)
   00281 Geraniol degradation
    EYD13_12610 (echA3)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EYD13_12610 (echA3)
   00627 Aminobenzoate degradation
    EYD13_12610 (echA3)
   00930 Caprolactam degradation
    EYD13_12610 (echA3)
Enzymes [BR:sacc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EYD13_12610 (echA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: QBQ60875
UniProt: A0A4P7CB06
Position
complement(2720468..2721328)
Genome map
AA seq 286 aa AA seqDB search
MSGSETTDQAPGEYVSLRVERTGHVAEVTLLGPAKGNAMGPDFWRELPVAFAELDADPEV
RAVVLTGSGRNFSYGLDLAAMLPSWSEYLGGGDGAGLARPRREFLDEIRRMQDSITAVAR
IRKPVIAAVSGWCIGGGVDLISAADVRLASADATFSVREVKVAIVADMGSLQRLASIIGE
GHLRELAFTGKDIDAARAEKIGLVNDVYADRDATLDAARGMAAEIAANPPLVVQGVKDVL
SVNTEQRIEAGLRYVATWNAAFLPSQDLNEAVQAFLQRRQPEFKGE
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcagcgaaacgactgatcaggcacccggcgagtacgtctcccttcgcgtcgag
cgcaccgggcacgtcgccgaggtgactctgctcggcccggccaagggcaacgcgatgggc
ccggacttctggcgcgaacttcccgtcgccttcgccgagttggacgccgaccccgaggtg
agggccgtcgtgctgaccggcagcggcaggaacttctcctacggcctcgatctcgccgcg
atgctgccgtcgtggagcgagtacctcggaggaggggatggcgcgggactcgcccgccct
cgccgcgagttcctcgacgagatccgcaggatgcaggactccatcacggccgtggcccgc
atccgcaagccggtcatcgccgccgtctccggctggtgcatcggcggaggagtggacctc
atctccgccgcggacgtgcgcctcgccagtgccgacgcgaccttcagcgtccgcgaggtc
aaggtcgccatcgtcgccgacatgggcagcctccagcggctcgcctcgatcatcggggag
ggacacctgcgggaactcgcgttcaccggaaaggacatcgacgccgcgagggccgagaag
atcggtctggtcaacgacgtctacgccgacagggacgccacgctcgacgcggcgcgcggt
atggcggccgagatcgcggcgaacccgccactggtggtgcagggggtcaaggacgtactc
tccgtcaacaccgaacagcggatcgaagcggggctgcgatacgtggcgacgtggaacgcc
gcgttcctgcccagccaggacctgaacgaggcggtgcaggcgttcctgcaacgcaggcag
cccgagttcaagggcgagtga

DBGET integrated database retrieval system